KEGG   Chenopodium quinoa (quinoa): 110694408Help
Entry
110694408         CDS       T05764                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 10 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqi01001]
    110694408
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110694408
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110694408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Pkinase_fungal ABC1
Motif
Other DBs
NCBI-GeneID: 110694408
NCBI-ProteinID: XP_021727270
Position
Unknown
AA seq 401 aa AA seqDB search
MKAKDFIKSMMNPFKFYSDKEGSKEADLQKIAAQEQKQFSYETLIKATDKFHSSHKLGEG
GFGPVFKGKLLDGREVAVKMLSQHSRQGQKEFINEAKLLARVQHRNVVNLLGYCTHGEDK
LLVYEYVSNESVDKLLFKPDKRQQLDWKKRYEVIAGVAKGLLYLHEDSHSCIIHRDIKAS
NILLDDKWIPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGV
LMLELISGQRNSSYNLSLDAQNLLDWAYKLFKKSRSLDVLDPSIASTADAEQVALCVQIG
LLCTQSDPNLRPSMRRVVVLLSRKPTSLEEPTRPGFPGSRYRRSRNPGGSSSHTASSGAS
SSTKTDHTSSTMSVTNTTTTTHTARSLGSDPRGKRPMRQSG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccaaagacttcatcaagagcatgatgaatccttttaaattctactctgacaaa
gaaggttcaaaagaggcagatttgcagaagattgcagcacaagagcaaaaacaattttca
tatgagacattaatcaaagcaactgataaatttcattcttctcacaagcttggtgaaggg
ggttttggtcctgtttttaagggtaaattgttggatggaagagaggtagcagtgaaaatg
ctgtcacagcattcaagacaagggcagaaagaattcatcaatgaggcaaagttgttagct
cgtgtgcaacatagaaatgttgtgaatttgttgggttattgtacacatggtgaagataaa
ctccttgtttatgaatacgtctccaatgaaagcgttgacaagcttctattcaagccagat
aagcgtcaacaacttgattggaaaaaacggtatgaagttatagcaggtgtagctaaagga
ttgctttaccttcatgaagactcacatagttgcatcattcaccgtgacatcaaggctagt
aatatcttacttgatgacaaatggatccctaaaattgctgattttggcatggctcgtctc
tttcctgaagatcaaacacatgtaaatactagagttgcgggtaccaatggttatatggct
ccagaatatgtcatgcatggccatttatcagtgaaagccgatgtattcagttttggagtt
ttgatgcttgagctgattagtggtcagcggaactcttcatacaatctatcccttgatgct
caaaatttacttgattgggcttacaagctattcaaaaaaagcagaagtctggatgttttg
gacccatcaatagcaagcacggcagatgcagaacaagtagctctatgcgttcaaatagga
ctgttatgcacccaatcagatcctaatttaaggccatcaatgcgtcgtgtagtggttttg
ttgtcaaggaaaccaacgagcctggaagaaccaaccaggcctggcttccctggttcaaga
tatcggaggtcacggaatccaggtggatcatcctctcatactgcatcttcgggtgcatct
tcctcaactaaaactgatcacacctccagtacgatgagtgtcaccaacaccaccaccacc
acccatactgctaggagtctaggttcagatcctcgtggtaaacggcctatgagacagagt
gggtaa

DBGET integrated database retrieval system