KEGG   Chenopodium quinoa (quinoa): 110694630Help
Entry
110694630         CDS       T05764                                 

Definition
(RefSeq) wall-associated receptor kinase-like 6
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqi01001]
    110694630
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110694630
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110694630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA cEGF EGF FXa_inhibition EGF_3 WAK Pkinase_fungal TMEM95 PIP49_C hEGF
Motif
Other DBs
NCBI-GeneID: 110694630
NCBI-ProteinID: XP_021727477
Position
Unknown
AA seq 771 aa AA seqDB search
MIKMFEVRGLYLLLPLLWSSVTKTTFATKIAKPGCQPSCGNVTIYYPFGIGSACSLRESF
IIDCNRSSSNDPPKPFLVGSNIEVLNISITGQMLIKSFVTTKLYRDGVAVESTPPYVEQT
DLTMYPLVYSDTENKLIVVGCDDFGFLVSESTYRGSSPLGMGCSVVCSNLSVVINGSCSG
FGCCQTTIPQRLYNFTLVLESNANHSNVSHVNPSGYAFIGNPSKFNFSVADLGDPNFVNR
TRDSVPVVLEWFVWDYYDFSHDISCEIAKRDLSYYACHHQSRCHDVDSGSGGYRCTCLPG
YKGNPYLSPGCTDIDECANLSSSPCSDICINTPGSYYCTCPKGYHGNGRKDGTSCIRDSV
PDYSKKNIVIGLAATLGSLLLPPIGWWLYIVIKKRETIKQKARNFKKNGGLLLQHRMLSD
ERIVERTYFFTVDELEKATDHFNESRILGRGGQGTVYKGMLGEGRLVAVKKSKTLNESQR
AHFINEVVIMSQIIHRNIVRLLGCCLESEVPLLVYEFVPNGTLFNHLHHLNEEFPITWRM
RLQIASDLAGALAYLHSFSYYPILHRDIKSSNILLDDKYRAKLSDFGLSKSVAPDQTHVT
TRVMGTFGYLDPEYFQTNHYTEKSDVYSFGVVLVELLTGQKAIRAICEQDRSLVSWFLSH
TENSQFLDIVDPDLVKESSKEEVYTIVDLATRCLNPKGHRRPTMKEVLLILETEESPQTD
EVETSSQFEQVLAAGTTNNSSYHENVATSSTSSMDTRYCQSSELSLLFNPR
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatgtttgaggtacgaggcttgtatctcctcctaccactgctatggtctagt
gttactaaaaccactttcgccactaaaatcgccaagcccggttgccaacctagctgtggc
aacgtaacgatttactatccatttggtatcggcagcgcatgttctcttagggagtctttc
ataatagactgcaatcgtagttccagcaatgaccctccaaaacccttcttggtcggcagt
aacattgaggtcctgaacataagcattaccggccaaatgcttattaagagctttgtgaca
actaaactataccgagatggagtagcagtagaatcaactcctccgtatgtagagcagaca
gatctcaccatgtatccacttgtatattccgacaccgaaaacaagctcatcgtcgttggt
tgtgatgattttggttttcttgtttccgaaagtacctatagagggtcgtctcctctcgga
atggggtgcagtgtagtgtgtagcaatttatcagtggtgataaacgggtcgtgttcaggg
tttggttgctgccaaacaaccatcccacagaggttgtataacttcaccttagtattagag
agtaatgcgaatcacagtaatgtgtctcacgtaaatccatctggttatgctttcatagga
aatccgagtaaattcaactttagtgtcgctgaccttggtgatcctaacttcgtcaataga
accagagacagtgttccggtggtgctcgaatggtttgtttgggattattatgatttttct
catgatattagttgtgagatagctaagagagacttgtcctactatgcttgccaccatcaa
agccgctgccacgatgttgatagtggctctggggggtacagatgcacttgtctacctggt
tacaagggtaatccttatcttagccccggatgtacagatattgatgagtgtgcaaatctt
tcaagctccccttgttctgatatttgtataaacactccgggtagttactattgtacttgt
cctaaaggatatcatggaaatggtcggaaggatggaaccagttgtataagagattctgtt
ccagattattctaaaaagaatatagttataggtcttgctgctactttgggatctctacta
ttgcctccaattggatggtggttatacatagtgataaaaaaaagagagactataaagcaa
aaggctagaaactttaagaaaaatggtggtttgttgttgcaacatcgtatgttgtctgat
gaacgcattgtagaaagaacatatttcttcaccgttgatgagttggagaaagccacggac
cactttaatgagagcaggatacttggacgaggaggacaaggtaccgtttacaaaggaatg
ctaggtgaagggagacttgttgctgtaaaaaagtctaagacattgaatgaaagccaacga
gcacatttcatcaacgaagtggttatcatgtctcaaataattcataggaatatagtcagg
ttactaggatgttgtttggaatcagaagtcccattattggtttatgagtttgtcccaaat
ggaacacttttcaatcatctacatcatctaaatgaagagtttccaatcacatggaggatg
cgcttgcaaattgcttctgatttagctggagcacttgcttatctgcattccttttcttat
tatcccatactacatagggacatcaaatcttccaacattcttttggatgataagtatagg
gcaaaactatcggattttgggttatcaaaaagtgtggctcccgatcaaacccatgtaaca
actcgtgttatgggaacattcggttatttggatcctgaatatttccaaactaaccactat
acagagaagagtgatgtttacagtttcggtgtggtccttgttgaacttttaaccggacaa
aaggcaatacgtgctatatgtgaacaagatagaagtttggtgtcatggtttctttctcat
acagaaaactctcaattccttgacattgtggaccctgatttggtaaaggagagttcgaag
gaagaggtttacactattgttgatcttgcaacacgatgcttgaatccgaaaggtcataga
agacccactatgaaagaagttctactaatactagagacagaagagtcgccccaaaccgat
gaagtagaaaccagctcacaattcgagcaagtgttagctgctggaacaactaataacagt
tcataccatgaaaatgttgcaacttcctccacatctagtatggatacacgttattgtcaa
tcatctgaattgtctttattattcaatcccagatga

DBGET integrated database retrieval system