KEGG   Chenopodium quinoa (quinoa): 110694668Help
Entry
110694668         CDS       T05764                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00480  Glutathione metabolism
cqi00590  Arachidonic acid metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110694668
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110694668
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110694668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 110694668
NCBI-ProteinID: XP_021727557
Position
Unknown
AA seq 171 aa AA seqDB search
MATYYSYAQPRSVHEFIVKDASGKDVNLSIYKGKVLLIINVASLCGLTKKNYTYLTQLYD
KYKDLGFEILAFPSNQFKQEPGTNEEIVEFACTNYKAEFPIFDKIEVNGSNAAPIFKYLK
STKRGFMGDRIKWNFTKFVVDKHGNVVDRISPFTPLKIVEKDLKKLLGVPK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttattactcttatgctcaacccagatcagtccacgaatttattgtcaaagat
gcaagtggtaaagatgttaatcttagcatttacaaagggaaggtattgttgattattaac
gttgcatcactatgtggtcttaccaaaaaaaactacacttacttgacacaattgtatgat
aaatacaaggacctaggatttgagatcttggcatttccaagtaaccagtttaagcaagag
ccaggaactaatgaggagatcgtggagtttgcgtgcacgaattacaaagctgaattcccc
atttttgacaagattgaagtgaatggtagtaatgctgccccaatatttaagtacttgaaa
tcaaccaaaagggggtttatgggagatagaataaagtggaattttaccaagtttgtagtt
gataaacatggtaacgttgttgatcgcatctcaccatttactcccctaaagatcgtcgag
aaggacttgaagaaactgctgggcgtccctaaataa

DBGET integrated database retrieval system