KEGG   Chenopodium quinoa (quinoa): 110695123Help
Entry
110695123         CDS       T05764                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00020  Citrate cycle (TCA cycle)
cqi00640  Propanoate metabolism
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110695123
   00640 Propanoate metabolism
    110695123
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqi04147]
    110695123
Enzymes [BR:cqi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110695123
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110695123
Exosome [BR:cqi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110695123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 110695123
NCBI-ProteinID: XP_021728034
Position
Unknown
AA seq 424 aa AA seqDB search
MVRGSLKNLLSKSLSFAGKWPQQQQQLRRLNIHEYQGAELMSKYGVNVPKGVAVSSVDEV
QKAIKESFAGQDEVVVKSQILAGGRGLGTFKNGLKGGVHIVKTDQAADIAGKMLGQILVT
KQSGPQGKPVNKLYLCEKMSLTNEVYFAITLDRTTLGPLIIACSKGGTSIEDLAEKYPDM
IIKVPIDVFKGITDEDAAKVVDGLALKSADKQASIEQVKNLYKLFCECDCTMLEINPLAE
TSDNQLVAADAKLNFDDNAAFRQKEIFALRDTSQEDPREVAAAKADLNYIGLDGEIGCMV
NGAGLAMATMDIIKLHGGTPANFLDVGGSASENQVVEAFKILTSDERVKAIMVNIFGGIM
KCDVIASGIVNAAKQVSLKVPLVVRLEGTNVDQGKRILKESNMTIITAEDLDDAAEKAVK
AASS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggttagaggatcgctcaaaaacctcctttctaaatctctctccttcgccggaaaatgg
ccgcagcagcagcagcagctccgccgtctcaacatccacgaatatcagggtgctgagctc
atgagcaagtatggtgtcaatgttcctaaaggagttgccgtatcttctgttgacgaagtt
caaaaagccatcaaagaatcttttgcaggccaggatgaggtggttgttaaaagtcaaatt
cttgctggtggacgtggattagggacatttaaaaatgggttaaaaggtggagttcacatt
gttaagacagatcaagctgcagacatagctggaaagatgcttggtcagatattggtcacc
aaacaaagtgggcctcagggaaaacctgttaacaagctttatttgtgtgaaaagatgtcg
ctgactaatgaagtttactttgccatcacgcttgatcgtactactcttggtcctcttata
attgcttgcagcaaaggaggaacaagtattgaagaccttgctgaaaagtatcctgacatg
atcatcaaggtacctattgatgttttcaaaggtattaccgatgaagatgctgctaaggtt
gttgatggtcttgctctcaagtcggctgataagcaggcttccattgaacaagtgaagaac
ttatataagcttttctgtgaatgtgattgcaccatgctggagatcaatcctcttgcagag
acttctgacaaccaattggttgctgctgatgctaaactcaattttgatgacaatgctgca
tttcgtcagaaagagatatttgctctacgcgacacatcacaagaggatcctcgcgaggtt
gctgctgccaaagctgatttgaactatattggtctggatggagagattggttgcatggtc
aatggagctgggttggctatggccacaatggatataattaagttgcatggaggaacacct
gccaactttttagatgttggtggcagtgcttctgaaaatcaggtggttgaagcatttaag
atattgacttctgatgagagagtaaaggcaattatggtgaacatttttggaggaatcatg
aagtgtgatgttatagccagtgggatcgtaaatgctgcaaaacaggtctcgttgaaggta
cctttggttgttcggcttgaagggacaaatgttgaccagggaaagagaatattgaaggag
agtaatatgaccatcataacagctgaagacctcgatgatgcagctgaaaaggctgtgaaa
gcagcatccagttga

DBGET integrated database retrieval system