KEGG   Chenopodium quinoa (quinoa): 110695777Help
Entry
110695777         CDS       T05764                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 3, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00010  Glycolysis / Gluconeogenesis
cqi00030  Pentose phosphate pathway
cqi00051  Fructose and mannose metabolism
cqi00710  Carbon fixation in photosynthetic organisms
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01200  Carbon metabolism
cqi01230  Biosynthesis of amino acids
Module
cqi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cqi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
cqi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cqi_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
cqi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110695777
   00030 Pentose phosphate pathway
    110695777
   00051 Fructose and mannose metabolism
    110695777
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110695777
Enzymes [BR:cqi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     110695777
Membrane trafficking [BR:cqi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    110695777
Chromosome and associated proteins [BR:cqi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110695777
Exosome [BR:cqi04147]
 Exosomal proteins
  Proteins found in most exosomes
   110695777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 110695777
NCBI-ProteinID: XP_021728703
Position
Unknown
AA seq 395 aa AA seqDB search
MATTSLVKLNAASSNWIGQHSFTQRPGSSSVAFPTRRVSLPVVRASSYVDELVQTAKTIA
SPGRGILAIDESNATCGKRLASIGLDNTEANRQAYRQLLLTTPGLGEYISGSILFEETLY
QSTTDGKKFVDCLREQNIVPGIKVDKGLSPLPGSNNESWCQGLDGLASRSAKYYQQGARF
AKWRTVVSIPCGPSALAVKEAAWGLARYAAVSQDNGLVPIVEPEILLDGDHPIERTLEVA
ERVWAEVFYYLAQNNVVFEGILLKPSMVTPGAEHKEKDSPESIAKHTLQMLRRRVPPAVP
GIMFLSGGQSEVEATLNLNAMNQSPNPWHVSFSYARALQNSVLKTWQGRPENAEAAQKAL
LVRAKANSLAQLGRYSAEGEDEEAKKGMFVKGYTY
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgactacaagtttggtgaagctaaacgctgcgtcttccaattggatcggtcaacac
tccttcactcaacgccccggatcatcttccgtcgccttccctactcgccgagtctccctt
cccgtcgtccgcgcttcctcttacgtcgacgagcttgttcaaaccgctaaaactattgcc
tctcctggacgtggtatccttgccattgatgaatctaatgcaacttgtggaaaaaggttg
gcgtctattggcttagataacacagaagctaatcgccaggcgtacaggcagcttctcctt
acgactcctgggctaggtgaatatatttctggttccatcctatttgaggaaacactttac
cagtctacaacagatggaaagaagtttgtggactgtctacgtgaacaaaacattgtacct
ggcatcaaagttgacaagggtttgtctccattgccagggtcaaataatgaatcttggtgc
caagggttagacggtttggcttcaagatctgccaagtactatcaacagggtgctcgcttt
gcaaaatggcgtacagttgtaagtattccatgtggaccttctgctttagctgttaaggaa
gctgcttggggacttgctcgttatgctgctgtttctcaggacaatggccttgttcccatt
gtggaaccagaaatccttcttgatggtgaccacccaatcgagaggactctggaagttgct
gagcgggtgtgggctgaagtcttttattacttggctcagaacaatgttgtttttgaagga
atccttctaaagccaagcatggttaccccaggagctgagcacaaagaaaaggattctcca
gaatccattgcaaagcatacacttcaaatgcttaggaggagagtgcctcctgctgttcct
ggaatcatgttcttgtctggaggtcaatcagaagtggaagcaaccttaaaccttaacgca
atgaaccaaagccccaacccatggcacgtctctttctcatatgctcgtgcactacagaac
agtgtacttaagacatggcaaggacgtccagagaacgcagaagctgcccaaaaagctctt
ttggtgcgtgccaaggcaaattcccttgctcagcttgggaggtactctgccgaaggggag
gatgaagaagccaagaagggtatgtttgtcaagggctacacctactaa

DBGET integrated database retrieval system