KEGG   Chenopodium quinoa (quinoa): 110697752Help
Entry
110697752         CDS       T05764                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00350  Tyrosine metabolism
cqi00360  Phenylalanine metabolism
cqi00380  Tryptophan metabolism
cqi00950  Isoquinoline alkaloid biosynthesis
cqi00965  Betalain biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110697752
   00360 Phenylalanine metabolism
    110697752
   00380 Tryptophan metabolism
    110697752
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    110697752
   00950 Isoquinoline alkaloid biosynthesis
    110697752
   00965 Betalain biosynthesis
    110697752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqi04147]
    110697752
Enzymes [BR:cqi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110697752
    4.1.1.105  L-tryptophan decarboxylase
     110697752
Exosome [BR:cqi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110697752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110697752
NCBI-ProteinID: XP_021730824
Position
Unknown
AA seq 516 aa AA seqDB search
MGSLDLKQESTPFMNNNNNNNNPLDPEEFRRQGYMVIDFLAEYYKNIEKYPVRSQVEAGY
LRKRLPESAPYNPESMETILKDIQTDIVPGLTHWQSPNYFAYFPSSGSTAGLLGETLAAG
FNVVGFNWISSPASTELESIVMDWLANMLSLPKTFTFASGGGGVMMGTTCEAILTTITAA
RDALLDKIGRDNINKLVVYGSDQTHCSFFKSAKIAGISPKNFRTIKTSKAHAFSLRPESL
RATIEADINAGLIPLFLVATVGTTSTAAVDPVGPLCDVAKEYNMWVHVDAAYAGNACICP
ELRHMIDGVEKADSFSFNAHKWFLTTLDCCCLFVKDPNSLVRCLSTNPEYLKNKATDTQQ
VVDYKDWQLTLSRRFRSLKMWMVIRSYGVDYLRNFLRSHVDMAIYFEQLVNKDKRFEIVV
PRSFALVCFRLSASAVIQCSGQKFLEEETLNEINTELLESINSAGRIYMTHSLVDGTFMI
RFAVGATLTEIHHVTCAWKVVQEHATAILARRSRNC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgggttcacttgacctcaaacaggaatctacccccttcatgaacaacaacaacaacaac
aacaaccccttagaccctgaggaattcaggagacaaggatacatggtcattgatttcctc
gccgagtactacaagaatatcgagaagtacccggttaggagccaagtcgaggccgggtac
cttcgcaagaggctaccggaatcagctccgtacaaccctgagtccatggagactatcctt
aaggacatccaaaccgatatcgtcccggggctaacacactggcaaagcccgaattatttc
gcatatttcccaagtagtggcagcacagctggtttactaggagagactttagctgcagga
ttcaatgttgttggattcaattggatatcatctcctgcttccactgaactcgaaagtatt
gttatggattggttagctaacatgcttagcttaccaaaaacctttacttttgctagcggc
ggcggtggtgttatgatgggaacaacctgtgaagccatcttaaccaccatcaccgctgct
cgcgatgccctcttagacaaaattggacgtgacaacatcaacaaactcgtggtttacggc
tccgatcaaactcattgctcattcttcaagtcagccaaaatcgccgggatttctcctaag
aacttccgcacaatcaaaacctccaaggcacacgccttttcgctccggccagaatcctta
agagccactattgaagccgatatcaacgccggcttgatcccactcttcctagtagccacc
gtggggaccacctcaacagccgctgtggaccccgttggacccctttgcgacgtagcaaag
gagtacaacatgtgggtccacgtagacgctgcctatgccggtaatgcttgcatctgcccc
gaactccgtcacatgatcgacggagtcgaaaaggccgattcattcagcttcaacgcacac
aagtggttcctcacaacactagattgttgctgtctttttgtcaaagaccctaactctctt
gtacgttgtttatcaaccaatcctgagtaccttaaaaataaggctacagacactcaacaa
gtcgttgactacaaagattggcagctaacacttagccgccggttccggtccctcaagatg
tggatggttattcgaagttacggagtcgactacctccgtaacttcctccgcagccacgtc
gacatggctatttactttgagcagttggttaacaaggataagaggttcgagatcgttgtc
cctaggagtttcgccttggtttgcttccgcctttcggcttcagctgtcattcagtgttct
ggacagaaattcctagaagaggaaactttgaatgagatcaacaccgagttactcgagtcc
atcaactcggctggccgtatttacatgactcattctctagttgatggcacttttatgata
cgtttcgcggttggagccacccttactgaaattcaccacgttacctgcgcatggaaggtt
gttcaagagcatgccaccgctattctagctcgcagaagccgcaattgctaa

DBGET integrated database retrieval system