KEGG   Chenopodium quinoa (quinoa): 110698990Help
Entry
110698990         CDS       T05764                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: methionine--tRNA ligase, chloroplastic/mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00450  Selenocompound metabolism
cqi00970  Aminoacyl-tRNA biosynthesis
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110698990
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110698990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cqi01007]
    110698990
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cqi03016]
    110698990
Enzymes [BR:cqi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110698990
Amino acid related enzymes [BR:cqi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110698990
Transfer RNA biogenesis [BR:cqi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110698990
 Prokaryotic type
   Other AARSs
    110698990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 110698990
NCBI-ProteinID: XP_021732170
Position
Unknown
AA seq 601 aa AA seqDB search
MAARVHTLQNNLWNLSPLSSINPKLNFLKKTALFRTNPLSSSSKSAMFCTCSSSNSQNDT
FVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLMEKKVIFVTGTDEHGEKIATAAAAVG
SSPGEHCDTISQAYRSLWKELDISYNKFIRTTNPKHEAIVNEFYSRVLANGDIYQADYEG
LYCVNCEEYKDKNELNEDNCCPIHLKPCISRKEDNYFFALSKYQKKLEDLLEQYPDFVQP
SARLNEVQGWVKTGLKDFSISRAAVDWGIRVPGDPDQTIYVWFDALLGYISALLENEEQS
SLQDAVASGWPASLHLIGKDILRFHAVYWPAMLMSAGFRLPNMVFGHGFLTKDGMKMGKS
LGNTIEPNELVQRFGADAVRYFFLREVEFGNDGDYSEDRFINIVNAHLANTIGNLLNRTL
GLLKKNCQSTLAFDSAIAGEGNSIKLKVENLVEKACTHYQNLSLSSACEAVLEIGNAGNV
YLDERAPWSLFKQGGTAAEAAAKDLVIILETMRIIAIALLPVAPSLSWRIYAQLGYTEDD
YNALTWNDTKWGGLKAGRLLPEAKPVFARIEFITDSDDVGVQPAKKTSKNKGKKAAKAQS
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagagtccatactctgcaaaacaatctttggaatctctctcctctttcttcc
atcaacccaaagctcaatttcctcaagaaaactgccttgtttcgcacaaacccactttct
tcttcatcaaaatcagccatgttttgcacctgttcttcctccaattctcagaatgacact
tttgtcctcactacccctctttattacgtcaatgcccctcctcatatgggtagtgcttac
accaccattgctgctgatgccattgctcgatttcagaggttgatggaaaagaaagtcata
tttgtgactggcacggatgagcatggagagaaaattgctactgcagcagctgcagttggc
tctagccccggtgaacactgtgataccatatctcaagcatatagatcgctctggaaagag
cttgatatttcttataacaagttcattcgcacaaccaaccccaagcatgaagcaatagtt
aacgagttctactccagagttcttgccaatggtgacatttaccaggctgattatgagggt
ttatattgtgtcaactgcgaagagtataaggacaaaaacgaattgaatgaggataattgt
tgccctattcatcttaagccttgtatatctaggaaagaagacaattacttctttgcttta
tcgaaataccaaaaaaaactggaagatctcttagagcagtatcctgattttgtccagcct
tctgctcgtctgaatgaggtccaaggttgggtaaagactggcttgaaagatttctcaatt
tctcgagcagcagttgactggggtatccgtgttcctggagaccctgatcaaaccatttat
gtttggtttgatgcattacttggctatatatcagcattattggagaatgaggagcaatct
agtttacaagatgcagttgcttctggctggcctgcttcacttcacttaataggcaaggat
atattacggtttcatgcagtgtattggccagccatgctgatgtctgctggattccgtctt
ccaaatatggtttttggccatggttttttgacaaaggatggcatgaagatggggaagtct
ttaggcaatactatagagccaaatgagttggtgcagaggtttggagctgatgcagttcga
tactttttcctaagggaagttgaatttggaaatgatggggattactcagaggatcgtttc
atcaatattgttaatgcacatcttgccaacactattgggaaccttctcaatcgtacactt
gggcttctcaaaaagaattgccaatcaactttagcttttgattctgctattgctggtgaa
gggaactcaatcaagctcaaagtagaaaatttggttgagaaggcttgtactcactatcaa
aatctctcattgtcttctgcttgtgaagctgtactagaaattgggaatgctggaaatgtt
tatctggatgagcgtgcaccatggtctcttttcaagcaagggggaactgctgcagaagct
gctgctaaggatcttgtgatcatattggaaactatgcgaatcattgccattgcattattg
ccagttgccccaagtctaagttggagaatatacgctcagcttggctacacagaagatgat
tacaatgctctgacttggaatgatactaagtggggtggtctaaaggctgggcgtctcttg
cctgaagcaaaacctgtctttgccaggattgagttcattactgactcagatgatgttggg
gtacaaccagctaagaagacttcgaaaaataagggaaagaaggctgctaaggctcaaagt
gcttag

DBGET integrated database retrieval system