KEGG   Chenopodium quinoa (quinoa): 110699275Help
Entry
110699275         CDS       T05764                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP19-4-like
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110699275
Enzymes [BR:cqi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110699275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 110699275
NCBI-ProteinID: XP_021732464
Position
Unknown
AA seq 240 aa AA seqDB search
MAISKRIIFPALLWLLALFGFLLLILNHLSDPGSPQLQKTSDPLVSSEHLGTGNEGKASD
GGLKEVTHRVFFDVEIDGKFAGRIVMGLFGKTVPRTVENFRALCTGEKGIGNSGKPLHFK
GSKFHRIIPSFMIQGGDFTVGDGRGGESIYGERFADENFKLKHTSPGLLSMANAGPDTNG
SQFFITTVKTNWLDGRHVVFGEVLSGMDIVHKIEARGTQNGIPRGKVVISNSGEIKSSSS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttccaaacggatcatatttcctgctctactatggcttctcgctctcttcgga
ttcttacttcttattctgaatcatttaagtgatcctgggtcacctcaattgcaaaaaact
agcgatccactcgtaagtagtgagcatttagggactggtaatgagggtaaggcgtcggat
ggtggactgaaagaagtcactcaccgtgttttctttgatgtcgaaatcgatgggaaattt
gctggacgaattgttatgggcctctttggaaaaacagtccccagaactgtagagaatttt
cgagcgctatgcacgggggaaaaaggaattggaaacagtgggaaacctctgcactttaaa
ggaagcaagtttcaccggatcattccaagttttatgattcagggtggtgatttcactgtt
ggtgatggccgcggtggagagtctatatatggtgagaggtttgcagatgagaacttcaaa
ctgaaacacactagtccaggacttctttcaatggcaaatgctggaccagataccaacgga
tcacagttctttattacaactgttaaaacaaactggttggacggacggcacgttgtgttt
ggtgaagtgttgtcaggaatggatattgtccacaagattgaggcgcgtggtacacaaaat
gggatcccaagaggcaaagttgtcatatcaaattccggtgaaataaaatcatcatcatct
tga

DBGET integrated database retrieval system