KEGG   Chenopodium quinoa (quinoa): 110699320Help
Entry
110699320         CDS       T05764                                 

Definition
(RefSeq) probable inactive receptor-like protein kinase At3g56050
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110699320
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110699320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRRNT_2 LRR_8
Motif
Other DBs
NCBI-GeneID: 110699320
NCBI-ProteinID: XP_021732521
Position
Unknown
AA seq 663 aa AA seqDB search
MNDYWWTNGFFTWSMLLLLGILQLNFIFSSSLNHEGIALLKFRERVVNDPYKALSSWKEE
NGEANPCSWFGIGCVGGRVVSLNLINLCLEGTLAPELHHLLHIKSIILRNNSFSGFIPKE
YRNLKELELLDLGYNRFCEPIPREIEQNIPTLLLNNNGLSCHMSPDVEDTTLLEIHEDKS
QLNNYVEVLPHPRQNDHAEEVVHSRILQEQLRGEARGSEPDEARAGVEANHHHSAESPIA
KAPSILTRKSPPPPSSDPAFRIPTPNLTKESSSLQPPPQPPPTPSTVNSSNKLIPIVAGA
VGGFIALTLVGLLLFLLRGNRIRKATGLSGQLKRAFVAGNDRSDGLSSNKPSFIEGMPNL
KRSELITACEDFSNVIGSSSIGTIYKGTFSNGVEIAVISLVAASAKDWSRNLETQFRKKI
ETLSKVNHKNFVNIIGYCEEEEPFTRMMVFEYAPNGSLFEHLHVKEAEHLDWAMRLRVAM
GMAYCLEHMHQLTPPVTHPNLNSSAVNLSEDYAAKISDFCFWNEVAVPRVQPLAIGLSSV
STTSVEPGSNVYSFGLLLLEMMTGRIPHSAENNSLDGWVLEYMRGEKLLKEMVDPMLRHF
KPEQLDKISEVTRKCLHSEQNRPTMIEVTARLKEITGIIPDKAVPRFSSLWWTELDARSV
NGT
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattattggtggaccaatgggttctttacatggagcatgctgcttttacttggt
attttacagctcaatttcatcttttcttcttctctcaatcatgaaggaatcgctctatta
aagtttagagaaagagtggtaaatgatccatacaaagcattgtcaagttggaaggaggaa
aatggagaagcaaacccctgttcatggtttggaattgggtgtgttggaggacgtgttgtt
tccttgaacttgataaatctttgccttgagggaacactagctccagaacttcaccatctg
ctgcacataaagtctatcatattaaggaacaattccttttctggattcatacctaaagaa
tatagaaatttgaaagagttggagttgctagacttgggttacaatagattttgcgaacca
attccacgcgaaattgaacaaaacatcccaacccttttattaaacaacaatggattatcc
tgccacatgtctcctgatgtagaagatacgacgcttcttgaaattcatgaagataagagc
cagctgaataattatgtggaagtattaccacatcctaggcaaaatgatcatgcagaagag
gttgtacattcgaggatactacaagagcaacttcgaggtgaagctcgaggttctgagcct
gatgaggcacgtgcaggtgttgaagctaatcatcatcattctgctgaatctccaattgca
aaggccccatcaattcttacgagaaaatccccaccccctccatcatcagatcctgctttt
agaatcccaacacctaatttgacaaaagaatcctcatcactacagccgcctccacaacct
ccccctactccatcaactgttaattcaagtaataagttaattccaatagtggctggagca
gtaggtggatttatcgcattaactctagttggtttattattattcctattacgaggcaac
aggatcagaaaggcaacaggattgagtggtcagcttaagagagcatttgttgcaggtaat
gacagatcagatggactcagcagtaataagccaagctttatcgaagggatgccaaatctg
aagaggtctgagcttataactgcttgtgaagatttcagcaatgtcattggatcatcatct
attggtacgatatacaagggaacattttcaaatggcgttgaaatagccgttatatctctt
gtggcagcttctgccaaggattggtcaagaaatctggaaacacagttcaggaaaaagatt
gagactttatcgaaggtgaaccacaaaaattttgtcaatattataggctattgcgaggaa
gaggagccgttcactagaatgatggtttttgaatatgctccaaatggctcactctttgag
catttgcatgtaaaggaagccgagcatttagattgggctatgcggctgagggttgcaatg
ggaatggcatactgccttgagcatatgcaccaactaacaccaccagtgactcacccaaac
ctcaactcatcagcagtgaacctctctgaagattatgccgcaaaaatttccgatttctgc
ttttggaatgaagtggctgttccacgagtgcagcctttggctattggcttgagcagtgta
agtacaacatcagttgaacccgggagcaatgtctacagttttggcttgttgcttctagaa
atgatgactggtcgtatccctcattccgcggaaaacaactcacttgatggttgggtgttg
gaatatatgagaggggagaaacttcttaaagaaatggttgaccccatgttaagacatttc
aaaccagagcagctcgataaaattagtgaggtaacaagaaaatgtcttcattctgaacaa
aatagaccaacaatgatagaagttactgcaagattgaaggaaataacaggcattataccg
gataaagctgtaccacgattctcctctctttggtggacagaacttgatgctcgttctgta
aatggaacctag

DBGET integrated database retrieval system