KEGG   Chenopodium quinoa (quinoa): 110699325Help
Entry
110699325         CDS       T05764                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00010  Glycolysis / Gluconeogenesis
cqi00562  Inositol phosphate metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110699325
   00562 Inositol phosphate metabolism
    110699325
Enzymes [BR:cqi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110699325
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110699325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110699325
NCBI-ProteinID: XP_021732528
Position
Unknown
AA seq 559 aa AA seqDB search
MPHVIPLWVVIVHGSTRRQIFVLFHTIKLKIRERKPRNLPKNREMKVKVNVKVKSKMKEK
NSAIFMQHAILSLLILLLVPSSYARSTIDEPYDVRQHLSTVTRYGAVKDIVDNEFVPSNK
TDDCTPVHINLVARHGTRAPTKKRMREMDRLATSLQALIANAKERKLSLDNVPAWLLEWT
SPWKGKVKGGELIVKGEEELYDLGIRIRGKYPTLLNDDYHPDVYTIKATQVPRASASAVA
FSMGLFSERGSLGPGKHRAFAVSTESRASDLLLRFFDTCQSYKNYRENEEPAVEKIKEPI
FDEITHALIGRYGLNFTRQDISSLWFLCKQEASLLDITNQACDLFNPTELALLEWTDDLE
AFVLKGYGKSVNYRMGLPLLKDVVESMELAIKANEEALPSGSYEKARLRFAHAETVVPFS
CLLGLFLQGSEYNLVLKEKPLQLPPMPPKRRTWRGSVVAPFAGNNMLVLYSCPARKSKYF
VHVLHNEHPVPLPGCDNSDFCPFEVFKERILEPHMKDDYQAICTVKDVVPEPAYSKFSSL
FGWLFSWQGNAKDSDKADL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgccacatgtaattcccctatgggttgtcatcgttcacggtagcacacgtcgtcaaatc
ttcgttcttttccacactataaaactcaaaataagagagagaaaacccagaaatcttccc
aaaaacagagaaatgaaagtgaaagtgaatgtaaaagtaaaatcgaagatgaaagaaaaa
aattccgccatttttatgcaacatgcaatcctctctcttctcatactactactagtacct
tcttcctatgctcgatcaaccattgatgaaccttacgatgttcgtcagcatctttctact
gtaactagatatggagctgtgaaagatattgtggataatgaatttgtaccttctaataaa
actgatgattgtacacctgttcatataaatcttgtggctaggcatggaacaagagcccct
actaagaaacgaatgagggaaatggataggctagccacttcactgcaagcacttatagca
aatgcaaaagaacgtaaattatctttggataatgttcctgcttggctacttgaatggaca
tctccatggaagggaaaggtaaagggcggcgaattgattgtcaagggagaagaagaactc
tatgatcttggaatcaggattcgaggaaaatatccaactctattaaatgatgattaccac
cctgatgtgtatacaatcaaagcaactcaggttcctcgggcatctgctagtgctgtggct
ttttcaatggggctgttcagtgagagaggaagtcttggcccaggaaaacatcgggctttt
gctgttagtaccgaaagtcgtgcaagtgacttattgctgaggttttttgatacctgccaa
agctataagaactacagggaaaatgaggagcctgctgttgagaagataaaggagcctatt
tttgatgaaatcactcatgccttaatcggacgctatggattgaatttcaccagacaagat
atatcttctctctggtttttatgcaagcaggaagcatcattgctagacataactaatcaa
gcttgtgatctttttaatccgactgagcttgctctgctggagtggacagatgatctggaa
gcatttgtgttgaaaggatatggaaaatctgttaactaccgcatgggattgcctttgctt
aaagatgttgttgagtccatggaacttgctatcaaggctaatgaagaagctctgcccagt
gggagttatgagaaggcaaggcttcgatttgcacacgctgagactgtggttccattctca
tgtcttcttggtctctttcttcaaggatctgaatataatctcgttcttaaggaaaaaccg
ttgcagctccctcctatgcctcccaaaaggcgaacttggaggggtagtgtcgtggctcca
tttgctgggaacaacatgcttgtactttacagttgtcctgccagaaagagcaagtatttt
gttcatgtattgcataatgagcatccagtacctttaccgggctgcgacaactctgacttt
tgtccatttgaagttttcaaggaaaggatacttgagcctcatatgaaggatgattatcag
gccatctgcacggtgaaggatgttgtgccagagcctgcatacagcaagttttcatcgctg
tttggttggctgttctcctggcagggtaatgcaaaggattctgacaaagccgacttataa

DBGET integrated database retrieval system