KEGG   Chenopodium quinoa (quinoa): 110701245Help
Entry
110701245         CDS       T05764                                 

Definition
(RefSeq) aspartic proteinase-like isoform X1
  KO
K08245  phytepsin [EC:3.4.23.40]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cqi01002]
    110701245
Enzymes [BR:cqi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.40  phytepsin
     110701245
Peptidases [BR:cqi01002]
 Aspartic Peptidases
  Family A1: pepsin family
   110701245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N SapB_2 SapB_1 TAXi_C
Motif
Other DBs
NCBI-GeneID: 110701245
NCBI-ProteinID: XP_021734551
Position
Unknown
AA seq 503 aa AA seqDB search
MGIKYFSQILCFCALINICFLPITTYGLLKISLKRVDQQHKTNFNNIKFARKLGTIEVGK
RAEIIHLKNYMNSQFYGEIGIGTPPQKFAVIFDTAVSNLWVPSSKCNSSEACYLHSRYES
SHSSTYTKIGSPHEIIYGTEAKLTGFLSQDNVEIGGLLVKNQIIFEITSEESITLVHAKF
DGVVGLAFPDKSEGNANLIWYTMEEQKLLKKKVFSIWFNTDSEAESGGEVVFGGVDPNHF
KGKHVYVPVTPNQNGIWQIEIGELFIGNQSSGYCQEGCPAVLDSGSPLLSGPAVIVVEIN
HAIGAKGVKSKECKEIISHNGEKIYDLLASGVNPDDICSQLSLCLNNGAQHMRNNLKTAQ
ERINRKELLSFADELLCSACQKIVIWIQRQMKQRKTKKGILRYVRKLCFSFPTPRGDVEV
PCENIPLMPHLTFTIGNKPFTFTPQQYIRTTRKHRKMTCRSQFSAVDLPSLPGAWIFGNV
FMGVYHSVFDFSKPQVGFAEAVY
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgggtattaaatatttctcccaaattttatgtttttgtgcattaataaatatttgtttt
cttcctataacaacttatggattgttgaaaatcagtctcaaaagagttgatcaacaacat
aaaacaaattttaataatattaaatttgcaagaaagttgggtacaattgaagtgggaaaa
cgtgcagaaattatacatttgaagaattacatgaattcccaattttatggagaaattgga
attggcacaccacctcaaaaatttgctgtcatttttgatactgcagtttctaatctttgg
gttccatcttctaagtgcaattcttctgaggcttgctatttacattcaagatatgaatca
agccactcaagtacatacacaaagatagggtcaccacatgaaattatttatggaacagag
gcaaaactcactggttttcttagccaggataatgttgaaattggaggtttacttgtcaaa
aatcaaataatcttcgaaataacaagtgaagaaagcataacattggtacatgctaaattt
gatggtgtagtagggcttgcatttccagataaatcagaaggaaacgccaatcttatatgg
tatacaatggaagaacaaaaactactaaagaagaaagttttctcgatctggtttaacaca
gattcagaagcagaatcaggaggagaggttgtttttggaggagttgatcctaatcatttc
aagggaaaacatgtttatgttcctgtgacgccgaaccagaatggtatatggcagattgaa
attggagaactcttcattggtaaccaatcatccggctactgtcaggaaggctgtcctgct
gttttagactcaggatcaccattactttcgggccctgcggttattgtggttgagatcaac
cacgcaataggagcaaaaggtgtcaaaagcaaggaatgcaaagaaataatctcccacaat
ggagagaagatatacgatcttttagcatcaggggtaaatcctgatgatatatgttcacaa
cttagcttgtgcctcaacaacggagctcagcatatgaggaacaatctcaagacagctcaa
gaaagaataaacagaaaagaacttttatcatttgcagatgagttgctatgcagtgcctgt
cagaaaatagtgatttggattcagaggcagatgaaacagagaaaaacaaagaaaggaata
ctgagatacgttagaaagctatgctttagctttccgactcctcgaggagacgtagaagtt
ccttgtgaaaacatcccactcatgccacacttgacattcacaattggaaataagcctttc
acattcactcctcaacagtatatacgcacaactagaaagcaccgtaaaatgacctgccgg
agccaattttccgcggtggatctaccatcacttccaggagcatggatctttggaaatgta
ttcatgggagtttaccattcagtttttgattttagcaaaccacaagtgggttttgctgaa
gcagtttattag

DBGET integrated database retrieval system