KEGG   Chenopodium quinoa (quinoa): 110702052Help
Entry
110702052         CDS       T05764                                 

Definition
(RefSeq) protein S-acyltransferase 11-like isoform X1
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110702052
Enzymes [BR:cqi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110702052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC zinc_ribbon_15 Herpes_US9 FA_desaturase
Motif
Other DBs
NCBI-GeneID: 110702052
NCBI-ProteinID: XP_021735386
Position
Unknown
AA seq 371 aa AA seqDB search
MAAINVQRSPSPPPLEESNNGFLSQSLASTSPPSSQTLEQYPSSMEHDYESICWGCGLRL
ILPSNAPVFKCGWCGAITKQNESRREGKKLRWRRLRDRCFVSILLVFVSFVICGGLWAVY
PVIFSVSLFCGVFHSIVTFLLSVSTVSMFGLAAITDAGTPSPVVWGSYPAVRKDELQDYT
FCQYCSKPKSPRAHHCSSCGSCVLDMDHHCPFIGNCVGAGNHRYFIGFLIVAVISVTYAA
IMSAYAILHVLPSVGEGSFQEMHGLNSNIAFMGILKDIFIAFVTSAVFFSPRGLVLLYLF
VASISVGIGLTVLLWQQLYFIYEGRTYLTSLSSQDDAERDCRNLYRFFGFPHSFSLYFRV
CCNSKKIHRKL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggccgccatcaatgtgcaacgttctccttctcctcctcctctcgaagaatccaacaat
ggcttcctctctcaatcactcgcatctacttctcctccctcttctcaaactctggagcag
tacccatcttccatggaacatgattatgaatcgatatgctggggctgtggattgcgactt
attctcccatcaaatgcaccagtttttaagtgtggttggtgtggggcaataaccaaacaa
aatgaaagcagacgtgaaggcaaaaaattgcggtggaggcgtttacgtgatcgttgcttt
gtttctatcctccttgtatttgtgtcatttgttatatgtggtggtttgtgggctgtatac
ccagttatattttcagtgagcttattttgtggcgtattccacagtatagttactttccta
ttgtctgtgtctactgtttctatgttcggcctggcagccatcactgatgctggcactccg
tcgccagttgtgtggggtagctatccagctgtgaggaaagatgaattacaggattatact
ttctgccagtactgctctaagcctaaatcacctagagctcatcattgcagttcgtgtggg
tcttgtgtgttggacatggatcatcactgcccatttattggaaactgtgttggtgcagga
aatcatcgttatttcatcggcttccttattgtagctgttattagtgtaacgtatgctgcc
atcatgtctgcttatgcaatcctccatgtattaccatctgtgggtgagggatcttttcag
gagatgcatggactcaacagcaacattgcattcatgggcatcctaaaagacatatttatt
gcatttgtgacttctgctgtgttcttttcgccaagagggcttgttcttctttatctattt
gtagctagtatttctgtggggataggcttaactgtgcttttatggcaacaactatatttc
atctacgagggaagaacgtatttaactagcttaagttcacaggatgatgcagaacgggac
tgcagaaacctgtaccgattttttggtttcccacattccttttccctatattttcgtgtt
tgttgtaattctaagaaaattcacagaaagttatga

DBGET integrated database retrieval system