KEGG   Chenopodium quinoa (quinoa): 110703257Help
Entry
110703257         CDS       T05764                                 

Definition
(RefSeq) phosphopantothenoylcysteine decarboxylase-like
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00770  Pantothenate and CoA biosynthesis
cqi01100  Metabolic pathways
Module
cqi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    110703257
Enzymes [BR:cqi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     110703257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 110703257
NCBI-ProteinID: XP_021736729
Position
Unknown
AA seq 211 aa AA seqDB search
MAQGEPVTTHIEPVLANDTPRRPRILLAASGSVAAIKFGNLCHCFSEWADVKAVATKSAL
HFIDSVTIPEDVMLYTDEDEWSSWSKIGDNVLHIELRRWADIMVIAPLSANTLGKIAGGL
CDNLLTCVVRAWDYSKPLFVAPAMNTMMWNNPFTEKHLLSIDELGITLIPPVTKRLACGD
YGNGAMAEPSLIYKTIRLFLESHRLQAGSNV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaggagaacctgttactactcacatagaacctgtactggctaatgacacacct
aggagacccaggatccttctagctgcaagtggaagtgttgctgctatcaagtttggcaac
ctctgtcattgcttttctgaatgggctgatgtaaaagcagtggcgactaaatctgcattg
cattttattgacagcgtgacaattccagaagatgtgatgctgtacacagatgaggatgaa
tggtctagttggagtaaaataggtgacaatgtccttcacattgagcttcgcaggtgggct
gacatcatggttattgcccctctttcagcaaatactcttggcaagattgctggaggatta
tgtgacaatctgctgacatgcgttgtacgggcctgggactacagcaagcctttatttgta
gctccagctatgaacaccatgatgtggaacaacccatttacagagaagcatcttctgtca
attgatgagctcggcattactttgattcctcctgttacaaagaggctggcttgtggagat
tacggaaatggagccatggctgaaccatctctcatctataagaccatacgactgttcttg
gagtctcatcggctccaagctggctcaaatgtgtag

DBGET integrated database retrieval system