KEGG   Chenopodium quinoa (quinoa): 110704144Help
Entry
110704144         CDS       T05764                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03040  Spliceosome
cqi04141  Protein processing in endoplasmic reticulum
cqi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110704144
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110704144
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110704144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cqi01009]
    110704144
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqi03041]
    110704144
   03009 Ribosome biogenesis [BR:cqi03009]
    110704144
   03110 Chaperones and folding catalysts [BR:cqi03110]
    110704144
   04131 Membrane trafficking [BR:cqi04131]
    110704144
   03051 Proteasome [BR:cqi03051]
    110704144
   03029 Mitochondrial biogenesis [BR:cqi03029]
    110704144
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqi04147]
    110704144
Protein phosphatases and associated proteins [BR:cqi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110704144
Spliceosome [BR:cqi03041]
 Complex B
  Other components
   Prp19 complex
    110704144
 Complex C
   Prp19-CDC5 complex
    110704144
Ribosome biogenesis [BR:cqi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110704144
Chaperones and folding catalysts [BR:cqi03110]
 Heat shock proteins
  HSP70 / DNAK
   110704144
Membrane trafficking [BR:cqi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110704144
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110704144
Proteasome [BR:cqi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110704144
Mitochondrial biogenesis [BR:cqi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110704144
Exosome [BR:cqi04147]
 Exosomal proteins
  Proteins found in most exosomes
   110704144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl MutL MIF4G FAD_binding_8 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 110704144
NCBI-ProteinID: XP_021737619
Position
Unknown
AA seq 576 aa AA seqDB search
MEGKKELPAIGIDLGTTYSCVGVWQHGRVEIIINDQGNRTTPSCVAFNQTQRLVGEAAKN
QATSNPINTIFDAKRLIGRRFTDEIVQNDMKLWPFKVISASEDDKPVIVVTYKGEEKEFS
AEEISSMVLMKMKQTAETYLGSEVKNAVITVPAYFNDSQRQATKAASTIAGLNVMHIINE
PTAAAIAYGLNDMSNDRKDMAKNVLVFDLGGGTFDVSLVRISKQAYEVKAVNGDTHLGGQ
DFDSRMVDYFVSEFKRKHNKDISQERRAIGRLRYACERAKRMLSSATETSIDVDCLYEGI
DFYSTISRAKFEKLNLDLFKNCINPVKRCLEDANMKKGDVDDVVLVGGSTRIPKVQELLK
DFFKGKELCQSINPDEAVAYGAAIQAAILSGVRNNKDFTLVDVTPLSLGVRLYYGEMNIV
IPRNSTIPVKMSTILFTAYDGETTVPFSVYEGERPIAEDNNFLGTFTLYDIPPAPQGQEK
FDVCFEIDNDGILTVSAQHIGTDNKKQISIANHSGRLSKEEIDRMVEEANNYKAEDEQHK
KAVNAKLALQNYAESMLDMVEVRWNKFREFLNKRKS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtaaaaaagaattgccggcaataggaatcgatctcgggacaacatactcttgt
gttggagtatggcagcacggccgtgttgaaatcattatcaatgatcaaggaaacagaacg
acaccatcttgtgttgctttcaatcaaacccagcgtcttgttggcgaggctgctaaaaat
caggctacttctaatcctattaatactatttttgatgcaaagaggcttattggcagaaga
ttcactgatgaaatagtgcagaatgacatgaaactctggccttttaaggttatttctgcg
tctgaagacgacaaacctgttattgtagtcacctataagggcgaagaaaaggaattttct
gcagaggaaatctcttcaatggtcctaatgaagatgaaacagactgcagagacctacctt
ggctcagaagtgaaaaatgctgttatcactgtcccggcttatttcaatgattcccagcgt
caggcaacaaaagctgccagtaccattgctggactcaatgtcatgcacattatcaatgag
ccaactgctgctgccattgcctatggtctaaacgatatgagcaatgataggaaagacatg
gctaagaacgtgttagtttttgatcttggcggtgggacatttgatgtatctttggtcaga
attagtaaacaggcttatgaagtgaaagctgttaacggagacactcatttaggtggtcag
gattttgatagtagaatggttgactactttgtgtctgaatttaagaggaaacataacaag
gacatcagtcaggagcgcagggctattgggaggttgagatatgcttgtgagagggctaaa
aggatgctttcatcagctactgagactagtattgatgtagattgtctctacgagggtatt
gatttttattcaaccatctcccgtgccaagtttgaaaagttgaacctggatttgtttaaa
aattgtataaatcctgttaagagatgtttggaagacgccaatatgaaaaagggtgatgtt
gatgatgttgttcttgttggtgggtcaactagaattccaaaagttcaagaattgttgaaa
gattttttcaaagggaaggaactttgccaaagcattaacccggatgaggccgttgcatat
ggtgctgcaattcaagctgcaatcttgagcggtgtacgtaacaataaagacttcacacta
gtagatgttactcctttgtcccttggggttaggctttattatggtgaaatgaatattgtg
atcccgagaaattctaccattccagtgaaaatgtcaactattcttttcactgcttatgat
ggtgagacaaccgttccatttagtgtatacgagggtgagagacctatcgctgaagacaac
aacttcttaggtacatttactctgtacgatatccctccagcaccgcaaggtcaagaaaaa
tttgatgtttgctttgaaatcgacaatgatggtatccttactgtgtcagcgcagcatata
ggcactgacaacaaaaaacaaatcagtattgcaaatcacagtggtaggttatccaaagaa
gagattgatcggatggtagaggaagccaacaattacaaggcagaggacgagcagcacaaa
aaagctgtcaacgcaaagcttgcattacagaattatgctgaaagtatgttggacatggtg
gaagttcgctggaacaagtttcgagagtttctgaataagaggaaaagttga

DBGET integrated database retrieval system