KEGG   Chenopodium quinoa (quinoa): 110704150Help
Entry
110704150         CDS       T05764                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A-like
  KO
K03254  translation initiation factor 3 subunit A
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110704150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cqi03012]
    110704150
Translation factors [BR:cqi03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    110704150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 110704150
NCBI-ProteinID: XP_021737623
Position
Unknown
AA seq 940 aa AA seqDB search
MSTFAKPENALKRAEELINVGQKQDALQALHDVITSKRYRAWQKTLEKIMFKYIDLCVEM
RKGRYAKDGLIQYRIVCQQVNVNSLEEVIKHFMHLSTEKAELARNQAQEALEEALDVEDL
EADKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLENLYAMTA
HRAFQFCKQYKRTTEFRRLCEIIRNHLSNLNKYKDQRDRPDLTAPESLQLYLDTRFEQLK
IATELELWQEAFRSVEDIHGLMCMVKKTPKPSLMVVYYAKLTEIFWISGSHLYHAYAWLK
LFLLQKNFNKNLSQKDLQTIASSVVLAALSVPPYDHKRGASHMELENEKERNMRMSNLIN
FNLDSKPESREVLSRSALLLELVSKGVMSCVLPEVKDLYHLLEHEFLPLDLSLKVQPLLN
KISKLGGKLASASSVPEVQLSKYSLALEKLATLRLLQQASQVYQTMTIRSLSQMIPFFDF
SAVEKISVDAVKHRFINMKVDHMNGAVSFNILDLESDTLRNHLTVLAESLNKARSMIYPP
LNKASKIGDSLSGLAEVVEKEHKKLLARKTIIEQRKEEQERQLLEKEREEELKRLQQLKN
NEEAEQKRLAIELEKRKIQRIQKEIEEREKEETKALIQEKFSKNKKKPLIEGDNLTKQQL
MELALNEQLKEKQEMEKKLQKLSKQMDYFERAKREEAAPLIESAYQQRLVEEQLLHEREQ
QLEVELSRQRHDGDLQEKNRLARVMENKKIFQERVVGRRQSEFERLRQEREEHFRQIREA
RKQERVAQRKMLFYLRSEEERLNRLREEEEARKREEAERRRKEDAERQAKLDEIAEKQRQ
RERELEEKERLRRQQILAGEAARSSEASPLARPQAEAVPAAAAASAAPAAAAAAAAPAPT
KYVPRHLREKAAVPAPAPTADRWRSTDRRGSGGGSSRPTW
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctttgcgaaaccagaaaatgctttgaagcgagcagaagagctgatcaatgtt
ggtcagaagcaagatgccctgcaggcccttcatgacgttattacctccaaaagatacagg
gcatggcagaaaacgttggaaaagatcatgttcaaatacatagatctctgtgttgaaatg
aggaagggtaggtatgccaaagacggtttaatccaatatcgaattgtatgccaacaagtg
aatgtgaattctttagaggaagtaattaagcatttcatgcacttatcaactgagaaagct
gagcttgctcgtaatcaagctcaagaagcattagaagaagcacttgatgttgaagatctt
gaggcagataagcgtcctgaggatctaatgctaagttatgttagcggagagaagggaaaa
gacaggtctgatcgtgaacttgttacaccttggttcaaatttttgtgggagacatacaga
actgttttggaaatattacgtaataattcaaaattggagaatctttatgctatgacagca
catcgcgcttttcaattctgcaagcaatacaaacggaccacagaatttcgcagactgtgt
gaaataatcagaaaccatttgtcaaatttgaataaatacaaagaccaacgagacaggcct
gatctgacagctccagaaagcctgcagttgtatctcgacacgagatttgagcaactaaag
attgccactgaacttgaactttggcaggaagcatttcgctcggttgaagatatccatggc
ttgatgtgtatggttaagaagacacctaagccttcgttgatggttgtttactatgccaag
ctcactgaaatattttggatttctggtagccatctgtatcatgcatatgcttggctcaag
cttttcttgcttcagaagaactttaacaagaacttgagccagaaggatttgcagacgata
gcatcatctgtggttttggctgccctctctgttcctccttatgaccataagcgtggtgca
tctcatatggaacttgaaaatgagaaagagcgtaatatgaggatgtctaatcttattaat
tttaatcttgattccaaacctgagagcagagaagtgctctcacgctcagctcttcttttg
gaactggtttccaaaggagttatgtcttgtgtactgccagaagtgaaagatctttatcat
cttctagagcatgagtttctccccttggatttgtctctaaaagttcagcccttgttgaac
aaaatttctaagcttggtgggaaacttgcctcagcttcttctgtaccagaagtgcaattg
tcaaagtatagtcttgccttagaaaagctagcaactctgaggttgctacagcaggcttcc
caagtttaccagacaatgactattaggagtttatcccagatgattcctttttttgatttt
tctgctgtggaaaagatctctgtagatgctgtcaaacataggtttataaatatgaaggtt
gaccatatgaatggtgctgtttcgtttaatattctggatcttgaatctgataccttgaga
aatcaccttacagtgcttgctgaatcattgaataaggcaaggtccatgatatatcctccc
cttaataaagcatcaaaaattggagattctttatctggtttagctgaggttgtggagaag
gaacataagaagcttcttgctcgtaaaacaatcattgagcagcgcaaagaggaacaagaa
cgccagcttttggagaaggagcgtgaggaagagttgaagagactacagcagctaaaaaat
aacgaggaagctgaacagaaaaggcttgctattgaattggagaagaggaagattcagcga
atccaaaaggaaatcgaagaacgtgagaaggaagaaacaaaagctctgattcaggaaaaa
ttctccaaaaataagaagaaaccacttattgaaggggataatttgacaaagcaacaattg
atggagttggctctcaatgagcagctgaaggagaaacaagaaatggagaaaaagttgcag
aagttgagcaagcagatggattattttgagagagctaagagagaggaggcagctccacta
attgaatctgcatatcaacaacgcttggttgaggagcagcttcttcatgagcgtgagcaa
cagcttgaggttgagctcagcaggcagcgtcatgatggcgaccttcaggaaaagaacaga
cttgctcgtgtaatggaaaacaagaaaattttccaagaaagagtggtgggtcgccgccag
tctgaattcgaaagattgagacaagaacgggaggagcatttccgtcaaattcgtgaggca
cgtaaacaggaaagggtagctcagcggaagatgcttttctatttgagatcagaagaggaa
agattgaacaggctgcgtgaagaggaggaagcacggaagcgtgaagaggctgagagaaga
agaaaggaagatgctgagcgccaagctaagctggatgaaattgcagagaagcaaaggcaa
cgagagcgggaacttgaagaaaaggagaggctaagaagacagcagatccttgctggtgag
gctgctcggtcttctgaggcttctcctcttgccaggcctcaggcagaggcggtacctgct
gcagcagcagcttctgctgctccggctgctgctgctgctgctgctgctccagcacctacg
aaatatgttccgagacacttgcgggagaaagctgctgtgccagccccagctccaactgct
gacaggtggcgaagtactgatcgccgtggttcaggtgggggcagctcaaggcccacttgg
tga

DBGET integrated database retrieval system