KEGG   Chenopodium quinoa (quinoa): 110704567Help
Entry
110704567         CDS       T05764                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00260  Glycine, serine and threonine metabolism
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110704567
Enzymes [BR:cqi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110704567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Pyridoxal_deC Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 110704567
NCBI-ProteinID: XP_021738068
Position
Unknown
AA seq 374 aa AA seqDB search
MGEMGEVASQNDNAEMVKRVVDMRSDTVTKPTEAMRVAMANAEVDDDVLGNDPTALRLET
EMARIMGKEAALFVPSGTMGNLISVLVHCDVRGSEVILGDISHIHIYENGGISTLGGVHP
RTVKNNKDGTMDLDLVEAAIRDPKGELVYPITRLICIENSHANSGGRCLSVEYTDKIGEL
AKKHGLKLHIDGARIFNAATALGVPVDRLVQAADSVSVCLSKGLGAPVGTVIVGSKGFIS
KAKIMRKALGGGMRQVGILCAAALVALQDNVRKLEDDHKNTKLLADGLNKITGLKVDISS
VETNIVFVNLSENLNTTAPKLCKRLEEHGVLVMLENKFRFRIVIHHQITTSDVQYALSCI
KQAVTGASIEHIEE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaatgggtgaagttgcatcacaaaacgataatgccgagatggtgaaaagggtg
gtggacatgagatcagatacagttaccaagccaaccgaagcaatgcgtgtagcaatggca
aatgctgaggttgatgatgatgtattgggtaatgatccaactgctctccgcctcgaaaca
gagatggcaagaatcatgggcaaagaggcagcgctatttgttccttctgggactatgggt
aatctcattagtgtacttgtgcattgtgatgttaggggaagtgaagtcattcttggagat
atctctcatatacacatttatgagaatggtggtatttcaactctcggtggggtccatccg
agaacggttaagaataacaaggatgggactatggatttggatttggttgaggctgccatc
agagatcctaaaggagagcttgtgtatcccatcactagacttatttgtattgaaaactcg
catgcaaactctggtggtcgatgcctgtctgtagagtacacagacaagattggagagttg
gcaaagaagcatggtttgaagcttcatatagatggggcccgaatcttcaatgctgcaaca
gcacttggggttcctgttgatagactggtgcaagcagctgactcagtttcggtatgcctg
tcaaaaggtcttggagcgcctgtaggaactgtgattgtaggatcaaaaggctttatatca
aaggcaaagataatgaggaaagctttaggtggtgggatgagacaggttggtatattgtgt
gctgctgccttggttgcattgcaggacaatgtacgaaagcttgaggatgaccataagaac
actaagctattagcagatggattgaacaagattacagggctaaaagttgatattagttca
gttgagacgaatattgtgtttgtcaatttatctgagaatttgaacacaactgcaccaaaa
ctttgcaagcgcttggaagagcatggtgtattggtcatgctagaaaacaaattcagattt
aggattgttattcaccatcaaatcacaacaagtgatgtgcaatacgctttgtcatgcatt
aagcaagcagtaactggagcatcaattgaacacattgaggagtga

DBGET integrated database retrieval system