KEGG   Chenopodium quinoa (quinoa): 110704652Help
Entry
110704652         CDS       T05764                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960
Organism
cqi  Chenopodium quinoa (quinoa)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH DUF350 TMEM154 Haspin_kinase Protocadherin ECSCR ABC1 Glycophorin_A
Motif
Other DBs
NCBI-GeneID: 110704652
NCBI-ProteinID: XP_021738163
Position
Unknown
AA seq 515 aa AA seqDB search
MRKKEENWNSYNSNMEVLLSMMLGIICLSILTPSSAQDIVNEKNMPACWVNITNCMQDHL
DRSGSEPQYNSSSSMFNLSEFLCCPLIQQTSQTEKQSGSPPPDAIASGSSSSPILTSGKL
KIIIPVAASSVFIILLVISIVIALKCRKGKKKPEDVANSQSAGDVPPPLTDDQSVIVESL
QYEWEALKAATKNFSDDHMIGQGGFGIVYKGTLQNGQEVAVKRLSSGSCQGEKEFKNEVA
LVAKLQHRNLVKLEGFCLAKKEEKLLVYEFVANKSLDYFLFDAEKQRQLDWPKRYDIIKG
IARGLLYLHEDSPIRIIHRDLKAANVLLDEEMHPKIADFGMARIFDEKTYCHTSRIIGTY
GYMAPEYIIHGQFNVKSDVYSFGVLILEILSGIRISATSYQSGMTENLLSYGWKCWKDGR
SLEFINPTLRDSCSKTEITSCIHLGLLCVQEDMRKRPSMSTIALMLNSNFAVGALSMPQP
PAFMYSGNAGQSTMSNTASIPWSSGASTNDSNTML
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaaagaagagaactggaacagttacaactccaacatggaagtgttattgtca
atgatgttaggaattatttgtttgtcaatacttactccttcatcagcccaagatatagtt
aacgagaaaaatatgccggcgtgttgggtaaacataacgaactgtatgcaagatcattta
gacaggagtggatcagagccacaatataattcatcaagctcgatgtttaacttgagcgag
ttcctgtgctgccctctcatacagcagacttctcagacagagaagcagtctggatcacct
cctccagatgctattgcttccggatcatcatcgtctccaattcttacttcaggaaaactc
aaaattattattcctgttgctgcatcatcagtattcatcatacttttggtaataagcata
gttatagcacttaagtgtcggaaaggcaagaagaagcctgaagatgtagcaaattctcaa
agtgcaggggatgtgcctcctccacttacagatgatcaaagtgttatagttgagtccttg
caatatgaatgggaagccctcaaggccgccactaaaaacttctccgatgatcacatgatt
ggtcaagggggatttggcatcgtatacaagggcactttacaaaatggacaagaagttgca
gtaaaaaggctatcaagcgggtcatgccaaggtgaaaaagaatttaaaaatgaggttgca
ttggtagccaagcttcaacatagaaatctagtgaagcttgaaggattttgcttggcaaag
aaagaagaaaagttactcgtgtacgagtttgtggctaacaaaagtcttgactacttcctc
tttgatgctgaaaagcaaagacaattggattggccaaagcgatatgacattataaaaggc
attgctcgaggattgctctaccttcatgaagactctcccatccgaattatccatcgtgat
ctcaaggcagccaatgttttgttagatgaggaaatgcatcctaaaattgcagactttggc
atggctaggatttttgacgaaaaaacctattgccatacaagcagaattattgggacttat
ggttatatggctccggaatatataattcatggacaattcaacgtaaaatcagatgtctac
agctttggcgtgctaattttagagattttgagtggaataaggataagtgccacgagctat
caatcaggcatgactgaaaaccttctaagctatggatggaaatgttggaaagatgggaga
tcattggaatttataaatccaacactaagagactcttgctcgaaaaccgaaatcacgagt
tgtatacacctaggtttgttatgtgtccaagaagatatgaggaagagacctagcatgtca
actatagctcttatgctcaactctaatttcgcagttggagctttgtcaatgccccaacct
cctgctttcatgtatagtggaaatgcaggtcaatcaacaatgagtaacacggcttcaatt
ccatggtctagtggagcatcaaccaatgactcgaatactatgttgtga

DBGET integrated database retrieval system