KEGG   Chenopodium quinoa (quinoa): 110705760Help
Entry
110705760         CDS       T05764                                 

Definition
(RefSeq) calcium/calmodulin-regulated receptor-like kinase 2
Organism
cqi  Chenopodium quinoa (quinoa)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110705760
NCBI-ProteinID: XP_021739372
Position
Unknown
AA seq 416 aa AA seqDB search
MVNKTELAIICSSAGVLLGIFISSVVFFCFRWYKRRSDFENLGISNRPIRKNGCGLGLDS
SASMSESVVVPLPDLPAKSLPPLWLNHHNKDRTTSVSGIPKYLYKDIQKATQNFTNILGE
GSFGPVYKATMPAGGVAAIKVLASNSRQGEKEFQTEVSLLGRLHHRNLVNLVGYCVDKGQ
YMLIYEYMSNGSLEKRLYSEDDTLTWDERLQIALDISHGIEYLHEGAVPPVVHRDLKSAN
ILLDHSMRAKVADFGLSKEEVFDGRKSSLKGTYGYMDPAYISTSKSSLKSDIYSLGVIFF
ELITAIHPHQNLMDYVNLATMDPDGGVDEILDKRLIGKCSSEEAKSLAKIAFRCLHKTPR
KRPSSGEISQAIVKIKQRRLPKVGTMSFAGDDLNRLTSMIEDQQVELSKILSQNEN
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggttaacaaaactgagttggccattatatgctcctctgcaggagttttgttaggcatt
ttcatatcgtcagtggtatttttctgttttagatggtacaaaaggcgctcagattttgag
aatcttggtatatcaaatcgcccgatccgcaagaatggctgtggcctgggactagactcg
agtgcctcgatgtcagaatctgttgttgtccctctaccagatctcccagccaaaagcttg
ccacccttatggttgaatcatcataataaggatcgaacaacttcagtttcaggcatacca
aaatacttgtacaaggatattcagaaggctactcaaaatttcacaaacatattgggagag
ggatcgtttggcccagtatacaaggcaacaatgcctgcgggtggagtggcagccatcaaa
gtactagcttccaactctaggcagggtgagaaagagttccagaccgaggtatctttgtta
ggtagactgcatcaccgaaatttagtgaatttggtgggctactgtgtggataaagggcaa
tacatgttaatttacgagtacatgagcaatggcagtttggaaaaaagattatacagtgaa
gatgatacattgacttgggatgagagacttcaaattgctcttgatatttctcatggaatt
gagtatcttcatgagggggcagttccaccagttgtacatcgggacttgaagagtgctaat
atattactggatcactctatgagagcaaaggtcgctgattttgggctttcaaaggaagag
gtttttgatggacgtaaatcaagcctgaaaggtacatatggctacatggatcctgcatat
atctctacaagcaagtccagtttaaagagtgatatctacagcttaggggttatctttttt
gagcttataactgccatacatccacaccaaaacttgatggattatgtcaatcttgcgaca
atggacccagatggaggagttgatgagatacttgacaagcgactaatcgggaaatgcagc
tcggaagaagcgaagagtttggctaaaattgctttcagatgtttacataagacaccaagg
aagcgccctagtagcggagaaatctctcaggctatagtaaagataaaacagagacgtctg
cctaaagttggaacaatgtcatttgctggggatgatcttaaccgattaacaagtatgatt
gaagaccaacaagtggagttgagtaaaattttgagccagaatgaaaattaa

DBGET integrated database retrieval system