KEGG   Chenopodium quinoa (quinoa): 110705793Help
Entry
110705793         CDS       T05764                                 

Definition
(RefSeq) receptor-like protein kinase FERONIA
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110705793
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110705793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Malectin_like Malectin Kinase-like BatD TMEM154 APH PRIMA1 TNFR_16_TM Syndecan EphA2_TM
Motif
Other DBs
NCBI-GeneID: 110705793
NCBI-ProteinID: XP_021739420
Position
Unknown
AA seq 927 aa AA seqDB search
MLIYPQLLPSIFSLLLFLPIATSYQHNESYHPKDHCFIKFGLSKFDQSLEWRSDEDFLVD
PPSAVAANTSATAVGVKSPYDKARMFRATVTYSIPVNSSGPKLVRLYLYPPTSTIYNPVI
DTSTSSLNLIINGFQVLRNFSAYLVASNANANPNTTAQVSNGLVREIYVTVAEERDHSKK
SINLTFSPSSPNGFGFINSVEIISVPQWLYINRSSDNPQQVLYLEGGPPGYVLDPYDFPN
SLAMENVIRLNVGGYTVDPSQDTGIDRTWYNDVNFVRSFDGTPSYTAIHNSSTHIPYTVL
APNLVYSTMRMMGPYIKRLKKNMTWEFEVDNGFNYLVRLHFCELDPTFFNNINRRLFSIY
INNQMAWQNMDVLRVAGGLYIPIHTDFVILVNETSSRSRVLLSVTLIPDFDTHYADALLN
GLEIFKLSSTSGSLAAPNPAPSKSMIQAPISTQTPAKSKHLPLIIGSILGATLVSLLIFV
CLIIIYRRNKKQQKYVSTTTTEKSSKLKWILPLYDSASSTVTTASVASKLPSDLCRYFTL
AQIKAATRDFDKDLIIGTGGFGKVYKGTFDDGNTTVAIKRLNSTSKQGAHEFQTEIEMLS
RLRHVHLVSLIGYCEDFGEMILVYEYMPNGTLRDHLLYKHNPQISHTSLSWKQRLMICLG
SARGLHYLHAGAKHLIIHRDVKSTNILLDEKWTAKVSDFGLSKVGPDHTEAGATYVSTAV
KGSAGYLDPEYYRCHQLTEKSDVYSFGVVLFEVLCARAAVNPNLPKQQANLAIWARSHYK
KGTLHTIVDPNLTGQIAPESLRKFGEIANMCVRDRGIERPSMGDVVWGLEFALQLQETAE
DNNIANGTPDESFDLSISYLSAIDVGFTDNDISTNSGDNFSQSSVVEGTSKKFMDSNSKS
TTSSSSDYLAHSKPGSVFSEITHPTAR
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgcttatctaccctcaacttctcccttcaattttctcactactcctcttcctaccaatt
gctacctcttaccaacataatgaatcgtaccatccaaaagaccattgttttatcaaattt
ggcctctctaaatttgaccaatcccttgaatggcgaagcgacgaagattttctcgttgat
ccaccatccgccgtagctgctaacacatcagctacggcggtgggggtcaaatcaccatat
gacaaggccagaatgtttcgagccactgtcacttattccattcccgtcaattcttcgggg
cctaaactcgtccgcctctacttatacccaccaacctcgacaatctataaccccgttatc
gacaccagtacatcttccctcaacctcataataaatggattccaagtactacgcaacttt
agcgcataccttgttgcttccaacgctaatgccaacccaaataccacagcgcaagtaagt
aatggccttgtgagggagatctacgtcaccgtagcagaagaacgagatcatagtaaaaaa
tctatcaacttaaccttctctccaagcagtcctaatgggttcgggttcatcaacagcgta
gagattatatctgtgcctcaatggctgtacattaaccggtcatcggataacccgcaacaa
gttctttatctagaaggtggtcctccaggttatgtgttggatccttatgattttccaaac
tctttagctatggaaaatgttatacggttgaatgttggtggatacactgtggatccttct
caagacactgggattgaccggacttggtacaatgacgttaactttgtgcgttcttttgac
ggcaccccaagctacacagccattcacaattctagtacacacatcccttacacagtacta
gcgcctaatttagtctactccacgatgaggatgatggggccgtatatcaaacgcctaaag
aagaacatgacatgggagttcgaggttgataatggatttaattatctggtgagactccat
ttttgtgagttagaccctaccttcttcaacaatattaaccgtagattgttctctatatac
atcaacaatcaaatggcctggcaaaatatggatgtccttcgtgttgctggcggcttgtac
attccaattcatacagattttgtaattcttgtcaatgaaactagtagccggagcagagtt
cttctctcggtgacccttattcccgactttgatacacactatgccgatgcattgctcaat
gggctggagattttcaagttgagctcaacaagtggttcgcttgctgcaccaaatcctgct
ccctccaaaagtatgatacaagctcctattagtacacaaacaccagcaaaatcaaaacat
ttgcctctaatcatcggaagcatccttggagcgactctagtttcacttttgatatttgta
tgtcttatcatcatatatcgaaggaataagaagcagcaaaaatacgtgagtacaaccacc
acggagaagagtagcaagttaaagtggatattaccattatatgattccgccagctccacg
gtaactacagctagtgtggcttctaaactgccgtctgatctttgccggtatttcacatta
gcccaaattaaggccgccactcgtgatttcgacaaagaccttattataggaactggtggg
tttggaaaagtttacaagggtactttcgatgatggaaacactactgtggctatcaagcgc
cttaactcgacatcaaagcaaggagctcatgagttccaaactgagatcgagatgttgtcg
aggctaagacatgtgcacttggtgtccttgattggatactgtgaagactttggtgagatg
atcctcgtgtacgagtacatgccaaatggcaccctacgagatcacttgttgtataagcat
aaccctcaaataagtcacacatcattgtcatggaagcaacgcctaatgatttgcttaggt
tcagctcgcggcctacattatctccatgcgggtgcaaaacaccttatcatccaccgcgat
gttaagtctaccaacatccttctcgatgaaaagtggacggccaaagtctccgactttggc
ctctccaaggttggacctgaccatactgaagcgggtgctacttatgttagcaccgcggtc
aaagggagtgcagggtacttagatcctgaatactatcgatgtcaccaattgacggagaaa
tccgatgtgtactcctttggagtagtcttgttcgaagttttatgtgctcgcgctgcagtg
aacccaaaccttcctaaacaacaagcaaatttagcaatatgggcacgaagtcactacaaa
aaaggaaccctccatactattgtagacccgaaccttacggggcagattgcacccgagagt
ctaaggaagttcggtgagatagctaacatgtgtgttcgtgatcgagggatcgagcgtccc
tcgatgggagacgtagtgtgggggttagagtttgcgttacaacttcaagaaactgccgaa
gataacaacatcgcaaatggtacaccggatgaaagtttcgatctaagtattagttatcta
agtgctatcgatgttggttttacagataatgatatatcgacgaactcaggagataacttt
tctcaaagtagtgttgtcgaaggtacttcaaagaagtttatggacagtaacagtaaatct
acgacgagttcatcttcggattatcttgctcattccaaacctggttcagtcttttctgag
atcactcatccgacagcaagatga

DBGET integrated database retrieval system