KEGG   Chenopodium quinoa (quinoa): 110706872Help
Entry
110706872         CDS       T05764                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00601  Glycosphingolipid biosynthesis - lacto and neolacto series
cqi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    110706872
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    110706872
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cqi01003]
    110706872
Enzymes [BR:cqi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     110706872
Glycosyltransferases [BR:cqi01003]
 Glycan extension
  P blood group
   110706872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 110706872
NCBI-ProteinID: XP_021740541
Position
Unknown
AA seq 440 aa AA seqDB search
MDKPPTHITRNDDFSKLQSLFSKNLPKKPINLCFPTSIFAIVLLLILGYNSFTIFYFIPI
FSMENVKETEKNMPISQLSSSRANFAMNDESFPKFSTKTHVKSSHNSPKFTHLSPKTIRR
VRQVIKPPSQEPLHEMRSFSRRVRRFFDENSCKFRVFMTWISSIKSFGDREKFTIESLFK
FHPNACLIIVSNSMDSNRGSQILEPFVRLNFKVMAVSPDFKFIFKNTMAAIWYQQLEKGN
VKPGEISLGQNLSNLLRLSLLYKYGGVYMDTDFIVIKRLDTLRNVIGAQTVDPKTKNWSR
LNNALMIFDKKHPLLIKFIVEFALTFDGNKWGHNGPYLVSRVVERVTNSSTKGGASKFTV
LPPSAFYVVEWGKVGDLFRKPMDELHQKWLDDKIDQIERDSYAIHLWNRQSREIKVEDGS
IIRHLMKKACVFCNVSRTIS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggataaaccacctactcatattactaggaatgatgatttctctaaacttcaatctctt
ttttctaaaaatcttcctaaaaaaccaattaatctttgcttccctacgtcgattttcgcc
atcgttcttcttttaattcttgggtataattccttcactatattctattttatcccaatt
ttttccatggaaaatgttaaagaaacagagaaaaatatgcccatttctcaattatcctca
tcaagagctaattttgcaatgaatgatgagagttttcctaaattttcgacgaaaacccac
gtcaaatcttcccataattctcctaaattcacccacttaagtcctaaaacaatccgaaga
gtcagacaagtgatcaaacctccttctcaagagcctcttcatgaaatgagatcattttcg
aggcgagtgaggcggtttttcgatgagaattcttgcaagtttcgggtatttatgacatgg
atatcgtcgattaagtcgtttggagaccgagaaaagttcaccattgagagcctcttcaag
tttcacccaaatgcttgtttgatcatagtgtcaaattctatggactcaaacagaggatca
caaattttagaaccctttgtaaggttgaatttcaaggttatggcggtttcgccggatttt
aagttcatattcaagaatacaatggctgccatttggtatcaacaattggagaaaggaaat
gttaagccaggagaaatttcattaggccaaaatctttcgaatttgcttagactttctctg
ctttataagtatggtggagtgtatatggacactgatttcatagttataaagagattagac
actctaaggaatgtgatcggagcacaaaccgttgatccaaagacgaaaaattggagtaga
ttgaacaatgctttgatgatatttgataagaaacaccctcttttgatcaagtttattgtg
gaatttgcacttactttcgatgggaataagtgggggcataatggtccttaccttgtttca
agggttgtggagagggtaaccaatagtagcacaaaaggcggtgcgagtaaatttacggtt
ttgcccccatctgcgttttacgttgtggagtggggtaaggttggtgacttatttagaaag
cccatggatgaacttcatcagaagtggttggatgataagattgatcaaattgaaagagat
agttacgcgattcacttgtggaataggcaaagtagagagattaaggttgaagacgggagt
ataattcgtcatttgatgaagaaagcttgtgttttttgcaatgtgtcaagaacaatctcc
tag

DBGET integrated database retrieval system