KEGG   Chenopodium quinoa (quinoa): 110707119Help
Entry
110707119         CDS       T05764                                 

Definition
(RefSeq) glutathione S-transferase-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00480  Glutathione metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110707119
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cqi02000]
    110707119
Enzymes [BR:cqi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110707119
Transporters [BR:cqi02000]
 Other transporters
  Pores ion channels [TC:1]
   110707119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 110707119
NCBI-ProteinID: XP_021740826
Position
Unknown
AA seq 214 aa AA seqDB search
MRIKVHGSPFSGATLRVVAALHEKELDFEFVSVDMKSGAHKQQPYLSLNPFGQVPAFEDG
EFKLFESRAITKYLTYAYKSKGTALVFEDLKQKAIRSVWMEVEALQFDPPARTLTWEIFL
KGMFGMETDMAIVEENKAKLAKVLDVYEARLGESKYLGGEIFTLVDLHHLPQLHMLMGTR
VKKIFEERPCVSAWCKDILARPAWEKTVALQNKA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcaaggttcatggaagcccattctccggagccacactccgagttgtggctgct
cttcatgaaaaagagctcgactttgaattcgtttcagtcgacatgaaatccggtgctcac
aaacaacaaccttatctttctcttaatccatttggtcaagtaccagcatttgaagatgga
gaattcaagctttttgaatcaagagcaattacgaaatacttaacatacgcttacaaaagc
aaggggactgcattggtgtttgaagacttgaagcaaaaggcgattcgatctgtttggatg
gaggttgaggctctccaatttgatccaccagcaaggactcttacttgggagattttctta
aagggcatgtttgggatggaaaccgatatggctatagtcgaggagaacaaggctaagtta
gctaaggtccttgatgtttatgaggcccgtttaggcgagtccaagtacttgggtggtgaa
atattcaccttggttgatcttcatcacttgcctcaattgcatatgctaatgggcactcga
gtgaagaagattttcgaggagcgcccgtgtgttagtgcttggtgtaaggatatcttggct
aggccagcttgggaaaagactgtggccttgcaaaacaaagcttaa

DBGET integrated database retrieval system