KEGG   Chenopodium quinoa (quinoa): 110708076Help
Entry
110708076         CDS       T05764                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP28, chloroplastic-like
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cqi03110]
    110708076
Enzymes [BR:cqi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110708076
Chaperones and folding catalysts [BR:cqi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110708076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 110708076
NCBI-ProteinID: XP_021741874
Position
Unknown
AA seq 327 aa AA seqDB search
MFSFYSAKFLPHVLPPQPQHRNLTTTTSTISSSSLSPHQHNTTSPSPTPTPTPYRDAQTT
RRSILLLSTAISLPTPPSSAANAPPLDTTITDRVFLDFSVCPNYFRTPTQGQAQDEPLCA
DSELMGRVVLGLYGKIVPITVSNFKAMCIGPMGYKNTLVHKILPGQFLVAGRQGRKDKGE
VVPPSSGLVRNTETVDSRAFMLEHSRPGVLSLCLSENDDEDDIKLDPNYHNVEFLITTGP
GPCPELDGRNIVFGSVLEGMDIVRAISSAPTYKPAERIRQLNDLAGFLGDERAQIARTFW
NRPLKSIYISDCGELKVTKPSLTPSLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttcagtttctattctgcaaagtttcttcctcatgtattgcctccccaacctcaacat
aggaatcttactactactactagtaccatttcctcttcttcgttatctcctcaccaacat
aacactactagcccaagtccaaccccaaccccaaccccataccgcgatgctcaaaccact
cgccgctccatcctcctcctctctaccgccatctctcttcctacaccaccctcctccgct
gccaatgctcctccactagacaccaccatcacggaccgggtcttcttagactttagtgtt
tgtccaaactactttcgaaccccaacccaaggccaggcccaagacgaacctctatgcgcc
gattctgagctcatgggccgtgttgtattgggcctctatgggaagattgttcccatcacg
gtctccaatttcaaggccatgtgcattgggcctatggggtacaagaatacattggttcat
aagatcctcccgggccaattcttagtggcaggccggcaagggaggaaagataaaggagag
gtggtgccaccttcttctggtctagtccggaacacggagacagtggactctcgggctttt
atgttggagcattcgaggccaggtgttctttccttgtgcttgtctgagaatgatgatgaa
gatgatattaaactagacccaaattatcacaatgtggaattcttgattacgactggacct
ggcccatgtccggagcttgatggtaggaacatcgtctttgggagtgtccttgaagggatg
gatatagtgagagcaatatcatctgcaccaacatacaaaccagctgaaaggataaggcaa
ttgaatgacttggcaggatttcttggagacgaaagagcccaaattgctcgaactttttgg
aatcgtcctcttaagtctatatatatcagcgattgtggtgaactcaaagttactaaacct
tcactcactccttccctcccatga

DBGET integrated database retrieval system