KEGG   Chenopodium quinoa (quinoa): 110708155Help
Entry
110708155         CDS       T05764                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL28
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110708155
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110708155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 110708155
NCBI-ProteinID: XP_021741953
Position
Unknown
AA seq 358 aa AA seqDB search
MPFGLVSAWNKRRRSKSQDQGESWIYKPVEFWQLEEQKPPAKRRQGSSVFTLKEMEAATK
SFSEENFIGKGGFGWVYKGTLRSGEVVAIKKMQLPPLKAAEGEREFRVEVDILSRLDHPN
LVTLIGYCADGKHRFLVYEYMQNGNLQDHLNSERKMDWSTRLKVALGAARGLAYLHSSSA
VGIPIIHRDLKSTNILLSTNFDAKISDFGLAKLMPEGQETYATVNVLGTFGYFDPEYTST
GRLTLQSDVYAFGVVLLELLTGRKAVNLNQGPTDQNLVLQARNMLNDRKKLRKIIDPELP
RNSYTMESIAMFANLASRCVRIDSTERPTMSECVNELQLIFHTNSKGLGMALHTLRMI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccctttggcttggtttcggcatggaacaaacggagaaggagcaaatctcaggaccag
ggtgaatcttggatttacaaacctgttgaattttggcaacttgaggaacagaagccacct
gcaaaaagacgccaaggatcatctgttttcaccctcaaggagatggaagcagcgaccaaa
tcattcagcgaagagaatttcataggaaagggaggttttggatgggtatacaagggcact
cttcgatcaggagaggttgtagcaatcaagaaaatgcagctgccaccacttaaagcagca
gaaggtgagcgtgaattccgggtggaagttgacatcttgagcagactggaccatccgaat
ctggttaccttaatcgggtattgtgccgatggaaagcaccggttccttgtatatgaatac
atgcagaatggcaacctacaggatcacttgaacagtgaacgcaagatggattggtcaaca
aggctcaaagtggcactaggggcagcaagggggcttgcttatctgcattcaagttcagca
gttggtatacctatcatccatagagatctcaaatccaccaacattcttttaagcaccaac
tttgatgcaaagatatcagattttggacttgcaaagttgatgccagagggacaagaaact
tatgcaacagtaaatgtactaggaacttttggctacttcgaccctgagtatacatcgaca
ggaagactgactctacaaagtgatgtttatgcatttggagtagtgcttcttgagcttttg
acaggacgtaaagcggtcaatttaaaccagggaccaacagatcaaaacctcgtattacag
gccagaaacatgctgaacgaccgaaagaagctgcggaaaattatagatcctgagctacca
cggaactcttacacaatggaatctatagctatgtttgcaaatttagcatcacgttgtgta
cgaatcgatagtactgaaagaccaaccatgtcagagtgtgttaatgagctccaactgatt
ttccatacaaattccaaaggcttaggtatggctctacatacacttcgaatgatctaa

DBGET integrated database retrieval system