KEGG   Chenopodium quinoa (quinoa): 110709402
Entry
110709402         CDS       T05764                                 

Definition
(RefSeq) delta(14)-sterol reductase-like isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00100  Steroid biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Module
cqi_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110709402
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110709402
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 110709402
NCBI-ProteinID: XP_021743312
Position
Unknown
AA seq 382 aa
MDLNSLLHSLIPSFTSVGLLLSYFGYLAIFGSVLPGKIVPGATLSDGTRLHYRCNGLLSL
TLLVLLLGGGVAVGFVSPTVCNLCCCGIMHFLVIVDRGLELLSATFIFCFVVTLLLCVAG
SISHDKGSSLKPHVSGNWIHDWWFGIQLNPQFMGIDLKFFFVRAGMLGWLLINLSILAKS
LQDSNLNRSMVLYQLYCTFYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSI
QGWWLLRNKVDLTTAAVVANCIVFLMGYRIFRGANRQKHVFKKNPKAPIWGKPPKVIGGK
LLASGYWGIARHCNYLGDLLLALSFSLPCGISSPIPYFYPTYLLILLIWRERRDEARCAE
KYKDIWAEYCKIVPWRILPYVY
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggatctaaattcacttcttcactctctcattccttctttcacctctgtgggtttattg
ttgtcgtattttgggtacttagctatattcgggtctgttctacccggcaagattgttcct
ggcgctactttaagcgacggcactcgtctccattatcgttgcaatggtttgttgtcattg
actttgttggtgttgcttcttggaggtggggttgctgttggattcgtatcacctacagta
tgtaatctctgttgctgtggcattatgcattttctagtcattgtggataggggacttgag
cttttatctgcgacctttatattctgctttgttgtaaccttgttactttgtgttgccggt
agcatttcacatgacaaaggttcatcgctgaagcctcatgtatctggaaattggattcat
gactggtggtttggaatacagctgaatcctcaatttatgggcattgatctcaaatttttc
tttgtgagagctgggatgctgggatggttacttattaatctttcaattttggctaaaagt
ttacaagatagcaacttaaatcggtctatggttttataccagctatattgcactttttac
atcctggactacttcttctatgaggaatacatgacttccacttgggacattattgcagag
agattgggctttatgctggtgtttggggatcttttgtggattcctttcacatttagtatc
caggggtggtggcttttgaggaataaggtggatttaaccactgctgcagtagtggcaaat
tgcatcgtctttttgatggggtaccgcatctttaggggagctaacaggcagaagcacgtg
tttaagaagaatcctaaagcaccgatatggggcaaacctcctaaggtcattgggggcaaa
ttgcttgcttctggctattggggaatcgctaggcactgtaattatctaggagatttgttg
ttggcactatccttcagtttaccatgtggaattagctccccaattccttacttttatcct
acatatcttcttattttgctgatctggagagagagaagagacgaagctcgatgtgcagag
aaatacaaagatatttgggctgagtactgtaaaattgtgccctggagaatattaccatat
gtttattag

DBGET integrated database retrieval system