KEGG   Chenopodium quinoa (quinoa): 110711459Help
Entry
110711459         CDS       T05764                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00520  Amino sugar and nucleotide sugar metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    110711459
Enzymes [BR:cqi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     110711459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 110711459
NCBI-ProteinID: XP_021745528
Position
Unknown
AA seq 437 aa AA seqDB search
MKQLHKQSSGNSVRRDEEIPMSQNSPYSPKSQKYHRSFPRSINYLFREQRLLFILVGILI
GSTFFILQPTLSRIGPQDSNFPKTAVSGRLGSTGLGSYDGGQGNWIGGKVGRVPAGIGRR
RMRIVVTGGAGFVGSHLVDRLVARGDDVIVIDNFFTGRKQNVAHHFGNPRFELIRHDVVE
PILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVYG
DPLEHPQKETYWGHVNPIGVRSCYDEGKRTAETLTMDYHRGADVEVRIARIFNTYGPRMC
LDDGRVVSNFVAQAIRKEPMTVYGDGKQTRSFQYVSDLVDGLMALMEGEHIGPFNLGNPG
EFTMLELAEVVKETIDPTATIAFKDNTADDPHKRKPDISKAKELLNWQPKVSLRDGLPLM
VADFRNRILNQDEGKAH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacttcacaaacaaagtagtgggaatagtgttaggagggatgaagaaataccc
atgtcacaaaattcaccatattcgccaaaatcacaaaaatatcatagatctttccctaga
tccataaattatttattcagagagcaaagattgttgtttattttggtgggtattttaatt
ggttcaactttcttcatcttgcaacctactttatctcgaattggtcctcaagattcgaat
tttccgaaaacagcggtttcgggtaggttagggagtactggcctgggttcgtatgatggg
ggtcagggtaattggattggtgggaaggttgggagagtgccagccgggatcggaaggcgg
cgaatgaggattgttgtgactggtggggctggatttgttgggagtcatttggtagatagg
ctagtcgcaagaggggatgatgttattgtgattgataatttttttactgggagaaaacag
aatgtggctcaccattttggaaatccgaggtttgaattgatccgtcatgatgttgtcgaa
ccgatattgcttgaagtggatcagatttatcacttggcttgcccggcgtctccggttcat
tacaagtacaatcctgtcaaaacgatcaagaccaatgtgatgggtacccttaacatgttg
ggacttgctaagagaattggtgctaggtttcttcttactagtacaagtgaggtatacgga
gacccgcttgaacatccacaaaaagaaacatattggggccatgtgaatcctataggtgtg
aggagctgctatgatgaaggaaagcgaactgccgaaactttaacaatggattatcaccga
ggtgctgatgttgaggtgcgtattgcacgtattttcaatacttatggacctcggatgtgt
ttggatgatggacgtgttgttagcaattttgttgctcaggccattcgtaaggaaccaatg
acagtctatggggatggaaagcaaactcgaagctttcagtatgtctctgacctggttgat
ggattaatggcactgatggaaggggagcatattggcccatttaatcttggaaatcctgga
gaattcaccatgctggagcttgcagaggttgtgaaagaaactattgatccaactgcaact
atagcgttcaaagataatacagccgatgacccccacaaaaggaaaccagatatcagcaaa
gcaaaagagctgttgaactggcagcccaaggtatctttaagagatgggctacctcttatg
gtagctgattttcggaatcggattctaaatcaggatgaaggcaaagcacactaa

DBGET integrated database retrieval system