KEGG   Chenopodium quinoa (quinoa): 110712919Help
Entry
110712919         CDS       T05764                                 

Definition
(RefSeq) beta-glucosidase 12-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00460  Cyanoamino acid metabolism
cqi00500  Starch and sucrose metabolism
cqi00940  Phenylpropanoid biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110712919
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110712919
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    110712919
Enzymes [BR:cqi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     110712919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 DUF1404
Motif
Other DBs
NCBI-GeneID: 110712919
NCBI-ProteinID: XP_021747075
Position
Unknown
AA seq 503 aa AA seqDB search
MRVDVQTHVFLVQLLVLVLFMLGHSNGAPEIDVIRADYGIGALNRSSFPAGFVFGSASSS
YQYEGAAHLDGKGLSIWDTFTHKFPDKIKDRSNGDVAIDSYHRYKEDVKILKQMGLDAYR
FSISWSRILPYGKSRRGVNQKGLAYYHNLIDELIANGIKPYVTLFHWDLPQALEDEYGGF
LSPYIVDDFRDYANVCFREFGNKVKHWITLNEPWTYSNGGYAYGILAPGRCSKWQQLNCT
GGDSSTEPYLVTHHQLLAHAAAVDLYRRKYQVSQKGVIGITLVATWFVPLFEVQRHQFAA
MRSLDFMFGWFMDPITKGEYPHTMQSLVKVRLPKFSAEQSRMVNGSFDFLGLNYYTANYA
AYSPDLKQAKPSYITDPIVRQTVKRNGILIGPKAGSDWLYVYPRGIRDLLLYVKRKYNNP
LVYITENGVDEANNNSLSLEEALSDKMRVQYHHDHLAFLNLAIKEGVNVKGYFAWSLLDN
FEWYSGSTVRFGINYVDYKDGLK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagagtagatgttcaaacacatgttttccttgtccaactactggtactcgtccttttt
atgcttggacactccaatggtgcccctgaaatcgatgtcattcgagccgattatgggatt
ggtgcactcaatcggagcagttttcctgcaggttttgttttcgggagtgcttcatcgtcg
tatcagtatgaaggtgcagctcatttagatggtaaaggcctgagtatatgggatactttc
actcataaatttccagataagatcaaagatcgaagtaacggtgatgtggctatagactca
taccatcgctataaggaggatgtaaaaatcctgaagcaaatgggattagatgcctataga
ttttcaatttcttggtcacggatattaccttatggaaaatcacgcagaggcgtgaaccag
aaaggattagcatactatcacaaccttattgatgagctaatagcgaatggtataaagccc
tatgtgactctcttccattgggatctcccacaagcattggaagacgagtatggtggtttc
ctcagtccttatatcgtggatgattttagggattatgcaaatgtttgcttcagggaattt
ggtaacaaagtgaagcattggattacattaaatgaaccttggacctatagtaatggtggg
tatgcgtatgggattttggctcctggacgatgttcaaaatggcaacagcttaactgtact
ggtggagattcatctactgaaccgtacttggttactcatcaccaacttcttgctcatgca
gcagcagtggatttgtataggcgtaaatatcaggtttctcaaaagggtgtaatcggtatt
actctagtggcaacttggtttgttccactgtttgaagtacaacgccatcagtttgcagca
atgagatcactcgacttcatgtttggatggtttatggatccaatcacgaaaggtgaatat
ccacataccatgcagtcccttgtaaaagtccggttgcctaaattttctgccgagcagtct
aggatggtgaatggatcctttgattttctgggtttgaattattacactgctaattatgca
gcttattctcctgacctgaagcaggcaaaaccctcttacattactgatcctattgtcaga
caaacagtgaagcgaaatggaattctaattggtccaaaggctggttcagattggctgtat
gtttatccacgaggaattcgagatcttttgctgtatgtgaagagaaaatataacaaccct
ttggtttatataacagagaatggtgttgacgaggctaacaataacagtttgtcacttgag
gaagcacttagtgataaaatgagggtgcaataccaccatgatcatcttgctttcttaaat
cttgcaattaaggaaggtgttaatgtgaagggctattttgcttggtcattgttggacaac
tttgaatggtactccggttctactgtccgatttgggatcaactatgtggactacaaagac
gggctaaaatga

DBGET integrated database retrieval system