KEGG   Chenopodium quinoa (quinoa): 110714228Help
Entry
110714228         CDS       T05764                                 

Definition
(RefSeq) biotin--protein ligase 2-like isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00780  Biotin metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    110714228
Enzymes [BR:cqi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     110714228
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     110714228
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     110714228
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     110714228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_C CCDC32
Motif
Other DBs
NCBI-GeneID: 110714228
NCBI-ProteinID: XP_021748415
Position
Unknown
AA seq 157 aa AA seqDB search
MEMDEQCVVVGCLMFSSSLAFISLFFLSGIGLNVDNKHPTTCLNARLRQIASMSCQLRKE
DILASFFNKFENFFDQFLSQGFKPLEELYYQTWLHSGQRVIVQDTREGQTVDNAATIQGL
TSSGYLLAIGDDGQMCELHPDGNSLDFFKRLVRHKLS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggagatggacgaacagtgcgtagttgttgggtgtcttatgttttcatcttctcttgcc
tttatatcattgttttttctttcagggattggattaaatgtagataataaacacccgacc
acttgcttgaatgcaaggttgcgacaaatagcctctatgtcctgccaactacgcaaagaa
gatatcttggcctccttctttaacaagtttgagaatttctttgaccagttcttaagccaa
ggtttcaaacctttagaggaactctactaccagacttggttgcacagtggacaaagagtt
attgtacaggatacacgtgaaggccaaacagtggataatgctgctactattcagggattg
acatcatcgggatatctattggcaattggagatgatggtcaaatgtgtgaacttcaccca
gatggcaatagccttgacttcttcaaaagattagtcagacacaaattgagttga

DBGET integrated database retrieval system