KEGG   Chenopodium quinoa (quinoa): 110715038Help
Entry
110715038         CDS       T05764                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqi01001]
    110715038
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110715038
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110715038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung APH NOB1_Zn_bind DUF4448 Pkinase_fungal MLANA
Motif
Other DBs
NCBI-GeneID: 110715038
NCBI-ProteinID: XP_021749302
Position
Unknown
AA seq 663 aa AA seqDB search
MLPILLVLLSSLVTSNSFPLGINFNESSCTNSSTNSISSSYETNLNQLLTSLVSQISTAK
NGFLTHKQGLRLKDSAYGLALCRGDSNPDECHGCIQMATKQITSFCPNATQAILWKEQCM
LRYSNQSFFSSLQEQPSTTLHNINNVTNNISAWYNVLQESLNNVTSMAASNESSNKYATT
SAWFSPMNVYLYTLAQCTPDLTTANCSNCFNAARAEIINNFIYRGRVVLTPSCTIRYELY
QFFQLSDSTLNLDPPPTDTAKTNREKASATKNAVAITVPLIALGLLLTGVFLYIKKRKKY
SSLDVKKVLGDLTTVESLMYELKTLEAATNNFSENQILGKGGFGSVYKGTLANGQEIAVK
RLSKISGQGVEEFKNEVVLIANLQHRNLVKLLGFCLAGEEMLLIYEFVPNKSLNYFLFDA
QKQGELKWSTRYDIIKGIARGLLYLHEDSRPRIIHRDLKSGNILLDAYMNPKIADFGLAR
MFKVEQTMDDTSRVVGTYGYMAPEYAMHGRFSVKSDVYSFGVVVLEIVSGKKISAKFHPS
GVGDLLSNAWRSLTEEKPLEYLDPTLHNSYSSDEVLRCIHLGLLCVQENANYRPTMSSVV
LTLSTDSTTTGTLPTPQFPRTFDNSSSTESSFMSRLSIHSTTTESELKASSKNQITISEM
NPK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccatcttacttgtgctactatcttcacttgttacttcaaattcttttccatta
ggtataaacttcaatgaatccagctgcacaaactcatcaactaattctattagcagttcg
tatgaaaccaatctcaaccaactcctcacctctttagtctcccaaatttcgaccgccaaa
aacggttttctaacgcacaagcaaggtctacgactaaaagattccgcatatggccttgcg
ttgtgccgtggagactcgaaccccgacgaatgtcatggttgtattcagatggctaccaag
caaatcacaagtttttgtccaaacgcaacgcaagcgatattgtggaaggaacaatgcatg
cttcgatattctaatcagtcctttttctcttcactacaagagcaaccctccacaacatta
cacaacattaacaatgtaacaaataatatttccgcttggtataatgtactccaagaatca
ttgaataatgtaacatctatggctgcttccaacgagtcatccaataagtatgccactacg
tcagcatggttttcgcccatgaatgtgtatttgtacactttagctcagtgcactcctgac
ttaacaacagcgaattgcagcaattgctttaatgcagctagagctgagattattaacaat
ttcatataccgtggaagagtcgtgttaactcctagttgtacaatcaggtacgagctttat
cagttttttcagttatcggattctactttgaacttagatccgcctcctacagatactgct
aaaacaaatcgagaaaaagcatcagcaacgaaaaatgccgtcgcaatcactgtgccatta
atagcattaggactgctacttactggcgtttttctctacataaagaaaagaaagaagtac
tcttctctagatgttaagaaagtgcttggtgatttgactactgtggagtctttgatgtac
gaactgaagacgcttgaagctgccactaacaacttttcggaaaatcaaattcttggtaaa
ggaggattcggaagtgtttataagggaactctcgcaaatggacaagaaatagcagttaaa
aggctatcgaagatttcaggccaaggagtggaggaatttaagaacgaggttgtattaata
gccaatcttcaacacagaaatctggttaagctactgggattttgtttagcaggagaagag
atgttactcatctatgaatttgttcctaataaaagccttaattactttctattcgatgca
caaaagcaaggagaattgaagtggtctacacgctatgatattataaaaggtattgctagg
ggactactttacctacatgaagactcgcgaccaagaatcattcaccgtgaccttaaatcc
ggaaatattttgcttgatgcatatatgaacccaaaaattgccgattttggtttggcaaga
atgttcaaggttgagcaaacaatggatgataccagcagagttgtgggaacatatggctac
atggctcctgaatatgcaatgcatggacgattttctgtaaaatcagatgtatatagtttt
ggcgtggtagttttggagattgttagtggcaagaagattagcgcaaaattccacccatcc
ggagttggagacctcttgtccaatgcttggagaagtttgacagaagaaaaaccattggaa
tatctggacccaaccttacacaattcttattcaagtgacgaagtcttgagatgcattcat
ttaggcctattatgcgtacaggagaatgcgaattatagaccgactatgtcaagtgttgtt
cttacgctcagcactgattcaacgacaaccggaacattgccaacacctcagtttcctaga
acctttgataatagcagtagtactgaatcatcttttatgtctaggttaagcatacactca
acgacaacggaaagcgaattaaaggcatcgtctaaaaatcaaatcacgattagtgagatg
aatcccaagtga

DBGET integrated database retrieval system