KEGG   Chenopodium quinoa (quinoa): 110715119Help
Entry
110715119         CDS       T05764                                 

Definition
(RefSeq) beta-glucosidase 11-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00460  Cyanoamino acid metabolism
cqi00500  Starch and sucrose metabolism
cqi00940  Phenylpropanoid biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110715119
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110715119
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    110715119
Enzymes [BR:cqi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     110715119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 110715119
NCBI-ProteinID: XP_021749386
Position
Unknown
AA seq 387 aa AA seqDB search
MDTYIQKGVFGKDVNNVSCDQYHKYKDDVKLMVDTGLDAYRFSISWSRLIPNGTGYVNPK
VVEYYNNLINELIQNGIQPHVTLLHNDHPQYLQDAYGGWMNKQMIEDFTYYANICFQEFG
DRVLHWITINEPNCCASFFSLSPFIEAHNFILGHASVVNLYKQKYEVCTITVRQHGSIGL
TICTSWYIPLRNTKEDLDAVERVHQFASGCYRCWSPWKKWGEILRIQYVQGVLEYFKQVY
GNPPIYIHENGVRTTRTSSLDDTSRVDFLSTSLRSLLDAARNGSNVKGFFQWSFLDVIEC
PGGYEFGLYYVDLDDPDLRRYPKLSAHWYSALLKRDGFRSSSVLKSGNQRSIEKRERQLL
QRDNSIETLKMVGKFDVYSLCIGAVNK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatacctatatccaaaaaggtgtttttggtaaagatgtcaacaatgtatcgtgtgat
cagtatcacaaatataaggatgatgtcaagttgatggtagatacagggttagatgcttat
agattctccatctcttggtcaagattaatcccaaatggaactggttatgtcaatccaaaa
gttgtggaatattacaataatctgatcaatgaactaatccaaaatggaattcagccccat
gtaacattgttacataatgatcatccacaatatcttcaagatgcatatggaggatggatg
aataagcaaatgattgaagacttcacatactacgcaaatatatgtttccaagaattcggg
gatagagttttacattggatcacaatcaatgagccgaattgttgtgcttcattcttttct
ctatctccttttattgaagctcacaactttatactagggcatgcatcagtagtaaatcta
tataaacagaagtacgaggtatgtacaataacagtgagacaacatggatctatcggtttg
actatttgtacaagttggtatattcctctaagaaatactaaagaagatttggatgcagtt
gaaagagttcatcaattcgcttctggatgctacagatgttggagtccttggaagaaatgg
ggtgagatattgagaatccagtatgtgcaaggagtactggaatatttcaaacaagtttat
ggaaatcctccaatttatattcatgaaaatggtgtacgtacaacccgtacttcatcattg
gatgacacatcaagagttgactttctaagcacttctttaagaagtcttcttgatgcagca
aggaatggatcaaacgtcaagggtttcttccaatggtcattcttggatgtaattgaatgt
ccgggaggttatgaatttggcctctattacgtagatttagatgatcctgatttgagaagg
taccctaaattgtctgcacattggtactccgcattgttgaaaagagatggatttcgtagt
tcctcggtcttgaagagtggaaaccaaagatcaatagagaagagagaaagacaactgttg
caacgagataatagtatcgagacattgaagatggtgggaaaatttgatgtgtattctctt
tgtattggggctgttaataaatga

DBGET integrated database retrieval system