KEGG   Chenopodium quinoa (quinoa): 110721030Help
Entry
110721030         CDS       T05764                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic-like
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00730  Thiamine metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    110721030
Enzymes [BR:cqi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     110721030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 Lycopene_cycl GIDA GMC_oxred_N HI0933_like FAD_oxidored NAD_binding_9 Pyr_redox_3 RNA_pol_Rpb1_3 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 110721030
NCBI-ProteinID: XP_021755846
Position
Unknown
AA seq 356 aa AA seqDB search
MASMASAALSSKLNKPAFLDSPIYGTPLTTPINKSISYKQQSSKSSISMSAAPAPPPYDL
NNYKFDPIRESIVSREMTRRYMTDMITYADTDVVVIGAGSAGLSCAYELSKNPDINIALI
EQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIEYDEQDNYVVIKHAALFTSTIMSKL
LARPNVKLFNAVAAEDLIVKSGRVAGVVTNWALVSMNHNTQSCMDPNVMEAKIVVSSCGH
DGPFGATGVKRLQDIGMIKTVPGMSALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGA
PRMGPTFGAMMISGQKAAHLALRALGLDNALDGPATEKLQPEFTLASAESSDVVDA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatggcatcagctgccctttcttccaagctaaacaagccagccttcttagac
tcacccatctatggcacccctttaaccacacccatcaacaagtccatctcatacaagcaa
caatcatccaagtcttccatctccatgtcggccgccccggccccacccccgtatgacctt
aacaactacaaattcgacccgatccgtgaatccatcgtgtctcgagagatgacccggcgt
tacatgaccgacatgatcacgtacgccgataccgacgtggtcgtgatcggggccgggtca
gccgggctcagctgtgcttacgagctcagcaagaacccggacatcaacatagcccttatc
gaacagtcggttagccctggcggaggagcgtggctcggtggccagcttttctccgccatg
gttgtccgtaaaccggctcatcgattcctcgatgagctcggtatcgaatacgatgagcag
gacaactacgttgtcatcaaacacgctgctctattcacttccaccatcatgtctaagctg
ttggccagacccaatgtcaagctgttcaacgccgtggcggccgaggacttgatcgtgaaa
tcgggccgtgtcgcgggtgttgttactaactgggccttagtgtccatgaaccacaacacc
cagagttgtatggacccgaatgttatggaggctaaaattgtggttagctcatgtggtcac
gacggtccgttcggagccacgggtgtgaaaaggttacaagacattggtatgatcaagact
gttcctggaatgagtgccttggacatgaactcggccgaggatgctattgtgagattgact
agggaagttgttcctggtatgattgttactggtatggaggttgctgagattgatggtgct
cctcgaatgggtccaacttttggggctatgatgatatcaggacaaaaggcggcccactta
gcactaagagcattgggcctagacaacgctcttgatggaccagcaaccgagaagctacag
cccgagtttacattggcttctgctgaatcttctgatgttgttgatgcttaa

DBGET integrated database retrieval system