KEGG   Chenopodium quinoa (quinoa): 110721096Help
Entry
110721096         CDS       T05764                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: protein PHYLLO, chloroplastic
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00130  Ubiquinone and other terpenoid-quinone biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    110721096
Enzymes [BR:cqi01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     110721096
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     110721096
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     110721096
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     110721096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C TPP_enzyme_M_2 Abhydrolase_6 Abhydrolase_1 Ndr Hydrolase_4 TPP_enzyme_C Abhydrolase_2 BAAT_C DLH Thioesterase DUF676 Abhydrolase_3 Esterase LIDHydrolase DUF2974 EPF
Motif
Other DBs
NCBI-GeneID: 110721096
NCBI-ProteinID: XP_021755916
Position
Unknown
AA seq 1417 aa AA seqDB search
MLENCCANMMKSTGNIFNMVEDRKMKMVYMEATLLGSYSNAASIVEMKNIAYACQFCIRL
SQKTAVSNSMLDDTSVTSSILQECANINSVWASLIVEECSRLGLTYFCIAPGSRSSPLAI
AASAHPRITCIACYDERSLAFHAVGYARGSRIPAVVITTSGTAVSNLYPAVVEASQDFVP
LVLLTADRPTELHAAGANQAIDQVNHFGSYVRFFFNLTAPTDHIKARMVLTTVDSAVNWA
TCSPCGPVQINCSFREPLDNSPQIWSRSCLDKLDVWISSTQPFTKYIKVQSSYAQAASYG
LTSEVERMIKNSKHGLLVVGAIHQEDEIWAALALAQHLSWPVVVDILSGLRLRKLLTSYR
EYEKNFIFIDHFDHVLLCDAVRQWAELDVIIQVGSKITSKRISQFLEHCSPCSYIMVNKH
PCRHDPSHIVTHRIQSTISQFTGGLLKDTFPCTSSKWSSFLQVANSVVAWELSFLICSEY
SLTEPHVAHIISEVVGSDTVLFIGNSMAIRDADMYSRGLVSCTNQTSQSALLCQGIHIAG
NRGASGIDGLLSTAAGFAVGCKKRALCIIGDVSFLHDTNGLAILSSRMGRKPMTILVINN
RGGGIFSFLPIAEKIDSEILGKYFYYNHHISVNELCAAHGVKHLLAETKLELHEALLTSQ
QDDADCVIEVSGAINTNASFHSLLQNYAAQAVSHAFTTLSQFSPPESSANDFLFKVAKLE
YSLYGVSLAAPSTSADRTLSNYVRQGFILALTLDDGSTGFGEIAPLEIHEENLQDVEEQL
RFLLHVLKGATISYQLPLLREAFSVWIWRVIGVPPGSLFPSVRCGLEMATLNAIAARQKC
TLLGVLWPQPVQINVKNQQPASIDICALVDAEGSPYEVASTVSALVEEGFRAIKVKVGRR
DDPREDGAVIKEIRRKIGAEIELRVDANRKWTYEKAIIFGSLVKDCGLQYIEEPVQCEED
ILRFCEDTGLPVALDETIDNIXGNLSDSLARFTHPGVVALVIKPSVVGGFENAAVIARWA
HIKGKLAVVSATFETSLGLSSYVQFAYYLEMRSSEISQAVDKKPRICVAHGLGTYKWLKE
DLTLDPLVICRQPKSRLVGASIDDADRVLCNFQVNCNAISRSSVEDSISTYHLGVKVDDC
SYVIKVQEMGERRDGNTLLFLHGFLGTGEDWTPIMTALSGSAKCLSVDLPGHGSSKLQSL
DGSGNPTEGQSLSIEVIAAVLSQLINKISTGKVTLIGYSMGARIALYMALRFSGQIDGAV
MISGSPGLRDEIERRIRAAKDDSHAQSIISFGLVPFLENWYSSDLWNSFREHPSYDKIVA
SRLEHHDIHGLAKALSGLSIGRQMPLWEDLKHCKIPLMFVVGEKDEKFKSISQNISRVMG
QTTIYEAVEVPDCGHAVHLENPLALVRLLRQFLTKTS
NT seq 4254 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaactgctgtgcaaacatgatgaagtcgactggcaacatctttaatatggtg
gaggatagaaagatgaaaatggtttacatggaagccacattgttgggaagttacagtaat
gctgctagtattgtggaaatgaaaaatattgcatatgcatgtcagttctgcatcaggctt
tcccagaagacagcagtttcaaacagtatgttggatgataccagtgtaacaagttctatc
ctgcaagagtgtgccaacatcaattctgtctgggcatcgcttattgttgaggaatgttct
cgacttggcttaacgtatttttgtatagctccaggatcaaggtcatctcctcttgcaatt
gcagcatcagctcatccacgtataacttgtattgcatgctatgatgagcgatcacttgca
ttccatgccgtcgggtatgccagaggatctcggatacctgctgttgttattacaacgtct
gggactgcagtttcaaatctgtaccccgctgttgtggaggctagtcaagattttgtacct
ctagtattgctcaccgctgatcgccctacagaattgcatgctgctggagcaaatcaagca
atagatcaggtgaaccattttggctcttatgtgagattcttcttcaatcttacggcacca
actgatcatatcaaagctagaatggttctcacaactgttgattctgctgtcaattgggct
acttgttcaccatgtggtcctgttcaaatcaactgctcttttagggaaccattggataac
agtccccaaatttggagtagaagctgtttagacaagctggatgtttggatctcaagcact
caaccttttactaaatatatcaaagtgcaatcgtcttatgcacaagctgcctcttatggc
ctaacatctgaggttgaaaggatgattaagaatagtaagcatgggctattagtcgttggt
gctatacaccaagaagatgagatttgggcagctcttgcattagctcaacatctttcatgg
cctgttgtggtggacatcttgtcaggcttacgattacgaaagctattgacttcttaccgt
gaatatgagaagaactttattttcattgaccactttgatcacgtgctgctctgtgatgca
gttaggcaatgggcagaattagatgtaattattcaggttggaagcaagataacaagtaaa
aggatttctcaatttctggaacattgctctccgtgttcatatataatggttaacaagcac
ccttgtcgacatgatccatcacacatagtgacgcatcggattcagagcacaatctctcaa
ttcactgggggtctgctgaaagacacttttccatgtacaagcagcaaatggagtagtttt
ctgcaagttgcaaattcggtggtggcatgggagttatcttttctaatctgctctgagtac
tctctgactgaacctcatgttgcacatataatttcagaagtagttggctctgatactgtt
ttattcattggaaatagcatggctatacgtgatgcagacatgtattctcgaggacttgta
agttgcaccaatcaaacatctcagtcagcattactatgtcaagggatacacatagcgggc
aatagaggagctagtggtattgacggtttgctaagtacagctgctggttttgctgtggga
tgcaagaaaagggcattgtgtataattggagatgtttcttttcttcatgatacaaatggt
ttggcaatattgagttcaaggatggggcggaagcctatgacaatacttgttatcaacaat
cgtggtggtgggatcttcagtttccttccaattgcagaaaaaattgactctgaaatattg
gggaagtatttctattataatcatcacatttcagtcaacgagctatgtgctgcacacggt
gtaaagcatctgctggcagagacaaaactggaacttcatgaagctttattaacatcccaa
caggatgatgctgattgtgtcatagaagtttcaggcgcgatcaacactaatgcatcattt
catagtctcttgcaaaattatgctgcccaagcggtgtctcatgctttcacgactctatca
caattttctcctccagaatcttctgcaaatgatttcttatttaaagttgccaaattggag
tactcgttgtatggagtcagccttgctgctccatcaacttcagctgacagaactctgtca
aattatgttagacaaggcttcattttagctttgactcttgatgatggaagtactgggttt
ggtgagattgcacctcttgaaattcatgaagaaaatttgcaagatgtggaagaacagctg
cgcttccttctccatgttctaaaaggagctactattagctatcaacttcccctgttgaga
gaggctttttctgtgtggatatggagagtaattggagttccgccaggatctctattccca
agtgttcgatgtggcctagagatggcaactttgaatgctatagctgcaagacaaaagtgc
actttgcttggtgtactctggcctcaaccagttcaaatcaatgtcaaaaaccagcagcca
gcaagcattgatatctgtgcccttgttgatgctgaagggagtccatatgaagttgcaagt
actgtatctgctcttgttgaagaagggtttcgtgctattaaagtaaaggtaggtcgcaga
gatgatccaagggaagatggtgcagtgattaaggaaataagaagaaagattggtgctgag
attgaacttcgtgtggatgctaaccgtaaatggacctatgaaaaggctatcatatttgga
tctcttgtcaaggattgtggcttacaatatatagaggaacctgtacagtgtgaagaagat
attttgaggttctgtgaagatactggcttgcctgttgcattagatgaaacaattgacaat
atttaaggaaatctatctgattctttggccagattcacgcatccaggagtggtggctctt
gtgattaagccaagtgttgttggcgggtttgaaaacgcagcagtaattgcacggtgggct
catattaagggaaaattggctgttgtgagtgcaacctttgaaactagtctcggattgtct
tcctatgttcagtttgcatattatcttgagatgagaagttcagaaatatcccaagcagta
gataagaaaccgagaatatgtgtagctcatggtcttggaacatacaaatggctgaaagaa
gatttaacgcttgatccacttgttatttgccgacagccaaagagtagacttgtaggagca
tctatcgacgatgctgatcgtgtcctctgcaattttcaagttaactgcaatgctatctca
agaagttctgttgaagatagcatatctacttatcatcttggcgtgaaagtagatgattgt
tcttatgtgattaaggtgcaagagatgggagaaaggagagatggaaatacacttctattt
cttcatggtttcctgggaactggtgaagactggaccccaatcatgacagccctttcagga
tctgcaaaatgcctgtctgttgatcttcctggccatggaagctcaaaattacaatcactt
gatggtagtggcaatccaactgaagggcaaagtttatcaattgaagtaattgctgcagtg
ttgagccagttgataaataaaattagcacagggaaagtcactcttattgggtactctatg
ggagccaggatagcattgtacatggcattgagattcagcggccagattgatggagctgta
atgatttctggaagtcctggtttaagagatgaaatcgagagaaggattcgtgctgcaaaa
gatgattctcacgcacagtcaattatctcctttggtttggtgccttttctggaaaattgg
tacagcagtgatttgtggaatagtttcagggaacacccaagttatgataagattgtagca
agtcgcttggagcatcatgatattcatggtctagcaaaagctttgtctggtttgagtatt
ggaaggcagatgccactctgggaagacttgaaacactgcaaaatacctcttatgtttgtt
gttggagaaaaagatgagaaattcaagagtatcagtcagaatatcagccgtgtaatgggt
cagacaacaatttatgaagcagttgaagttcctgattgtggacatgctgttcacttggaa
aatcctctagctcttgttagactactgagacaatttttgacaaaaacaagctag

DBGET integrated database retrieval system