KEGG   Chenopodium quinoa (quinoa): 110721129Help
Entry
110721129         CDS       T05764                                 

Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA12-like
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    110721129
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqi03021]
    110721129
Transcription machinery [BR:cqi03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     110721129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C DZR zinc_ribbon_2 Prok-RING_4 HypA zf-CHY zf-C3HC4_3 zf-RING_5 TerY_C
Motif
Other DBs
NCBI-GeneID: 110721129
NCBI-ProteinID: XP_021755949
Position
Unknown
AA seq 126 aa AA seqDB search
MDYSRRRDFLFCGSCGTLLSLDSTRYARCPLCRTRKSLKEVEGKGTCYTASGEDIRRALQ
MEPFVKVDGVMSGDVKVQRQEINQPCEKCGRSPVELVDSRQTRSADEGQTNFYECPSCRH
RWKENS
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggattacagtagaaggcgtgattttttgttttgtggctcgtgtggaacgttgttgtca
ttggattcaactaggtatgctcggtgccctttatgccgtacaaggaaaagcctcaaagag
gttgaaggaaagggaacatgttataccgcttcaggagaggatattagaagggcattacaa
atggagccattcgtgaaggttgatggagtaatgtccggtgacgtgaaagtgcaaagacaa
gagattaaccagccctgtgaaaagtgtggacgcagccctgttgagctggttgattcaaga
caaacgagatcagcagatgaaggacagactaatttctacgagtgcccttcatgtcgacac
cgatggaaggagaactcttag

DBGET integrated database retrieval system