KEGG   Chenopodium quinoa (quinoa): 110722272Help
Entry
110722272         CDS       T05764                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK8-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqi01001]
    110722272
   01009 Protein phosphatases and associated proteins [BR:cqi01009]
    110722272
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110722272
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: Other
  Wnk family
   110722272
Protein phosphatases and associated proteins [BR:cqi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110722272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 Rtt106 RIO1
Motif
Other DBs
NCBI-GeneID: 110722272
NCBI-ProteinID: XP_021757239
Position
Unknown
AA seq 327 aa AA seqDB search
MAGSSSSRGDGDYTVMETDPTGQYTRYSKLIDEGDLKKVYLGYDETNGREVAWCKKFVLL
NNLVHLMREAMSLKRFDHENVIKCYHYWPSGLQNKVEFNMITELYSGNLKDYTQKHQVKE
NSPAIKNWCQQILSGLEFLHSQNEQIIHGDLKCENIFVVGNSGKIKLGDLSVATTVDSPE
YNAVITRRIERSEMYCVGLCALQMVNKDAADSTSRKMDFRLLKKVQDQGLKSFIQVCVFF
EDVGTTITQLLKHPFLAPRTAPSDSTSVLFPWPLPTIQLQPTATITSAAAEPEGDVDDSN
TAAASENAPLIAETLAGREGDTSNGSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcgggttcgagttcaagcagaggagacggcgattatacggtcatggagacagatcct
acagggcaatacacaaggtacagtaagctgattgatgaaggcgatcttaaaaaagtttat
ttgggatatgatgagactaatggcagagaagttgcttggtgtaagaaatttgtattactt
aataatcttgttcatttgatgagagaagctatgtctttaaagagatttgatcacgaaaat
gtaatcaaatgctaccattattggccttctggattacagaacaaagttgagtttaacatg
attactgagctttattctgggaatttgaaggattacactcagaaacatcaggttaaagaa
aacagtccagcaatcaagaattggtgtcaacagattctgtcagggcttgaatttcttcac
agtcaaaatgaacagattattcacggtgatttaaagtgcgaaaacatctttgttgttgga
aactcaggcaagattaagctaggagatttgagtgtcgcgacgactgttgatagtcctgag
tacaatgctgttattactcgaaggatagagcggtctgagatgtactgtgttgggttgtgc
gcgctacagatggtgaataaggatgctgcagacagcacatcgcgaaaaatggattttagg
ctgttaaaaaaagtacaagaccaagggcttaagagcttcattcaggtgtgtgtgtttttt
gaagatgtcggaactacaataactcaactcctgaaacacccgtttcttgcaccgaggact
gcgccttctgacagcacatcagtactatttccctggcccttgcctacaattcaactgcag
cctactgctaccatcactagtgcagctgcagagcctgagggtgatgtcgacgacagtaac
acagctgctgcttctgaaaatgccccactgatagcagaaacactcgcaggacgggaaggt
gacacgtctaatgggagtgattaa

DBGET integrated database retrieval system