KEGG   Chenopodium quinoa (quinoa): 110723673Help
Entry
110723673         CDS       T05764                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PIX13
Organism
cqi  Chenopodium quinoa (quinoa)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 110723673
NCBI-ProteinID: XP_021758707
Position
Unknown
AA seq 337 aa AA seqDB search
MFSCLRNVSKKKELEQKAPDHEVGCSSSSLRNFDYKELKKATKNFSPTRSLTDVSVFKGF
MNEAVLTPSSFSTSKIPVVVKAYYCSVESSQHIRWQDELNFLGRLSHPNLIRLLGSGHCW
TKEQFFLVSEYMPKGSLNNHLLNGNTLSWDQRMNIALGVAQGLAFLDSSCSDIPWVYDYF
RPSRILLDQDYNAKISVFGLPKFSREENSKKHFIFKGSEYFSPDFLNTGHRTNHSIVYSF
GVILYMMLIGVHHAKDANREDWIERLSVSNKAELEKVIDPCLKGQCTLEVAFKVAQYTSK
CLGVRPAKSANRPSMQEVAFELAQLLKTAPNTHGGTE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgtgcttgcgtaatgtttctaagaaaaaagaattggaacagaaagcaccagac
catgaagtaggatgttccagcagtagcttgaggaatttcgattacaaggagttgaaaaag
gcaaccaagaacttcagcccgacgaggtccctcactgatgtttcagtgttcaagggtttt
atgaacgaggcggttcttactccatcatctttttccacttccaaaatccctgtggtagtc
aaggcatattattgtagtgtagagagtagtcaacatataagatggcaggatgagctgaac
ttcttgggaagattgtctcacccgaacttgattcgcttattaggatcaggacattgctgg
acaaaggaacaatttttcttagtgtctgaatatatgcccaaaggaagcttaaataaccat
ttgttaaatggcaatacacttagctgggatcagcggatgaacattgctttgggtgtagct
caaggcctagcgtttttggatagtagttgttctgacataccgtgggtgtacgactacttt
aggccctcaagaatacttcttgatcaggattataatgcaaagatatcggtttttggctta
ccaaaattttcaagggaagaaaactcgaaaaaacattttatttttaaaggttcagagtat
ttttctccagatttcttaaatacaggtcataggacgaaccatagcattgtgtatagtttt
ggagtgatattgtatatgatgctaataggcgttcatcatgctaaagatgcaaatagggag
gactggatagagcggctctcagtctccaacaaggcagaactcgagaaagttattgacccg
tgtttgaagggtcaatgtacactcgaggtagctttcaaggtggctcaatatactagcaaa
tgccttggtgtgcggcctgcaaagagtgcaaaccgcccgtctatgcaggaggtagcattt
gagttagctcaactgctgaaaactgcacctaatactcatggtggaacggagtag

DBGET integrated database retrieval system