KEGG   Chenopodium quinoa (quinoa): 110725581Help
Entry
110725581         CDS       T05764                                 

Definition
(RefSeq) probable glycosyltransferase At5g20260
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cqi01003]
    110725581
Enzymes [BR:cqi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     110725581
Glycosyltransferases [BR:cqi01003]
 Polysaccharide
  Structural polysaccharide
   110725581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin ETRAMP
Motif
Other DBs
NCBI-GeneID: 110725581
NCBI-ProteinID: XP_021760733
Position
Unknown
AA seq 476 aa AA seqDB search
MANTTTKFLLLIPTFLLIIFFYSSFLNQNHFNSNPTSNKKLSDPPSNLPVNISNEPNGHV
RHNISFSTILEKEEKEKEKEKKKKSSLEKIEEGLARARAAIREAARSRNYTFKEQVTTFI
PRGSVYRNQHAFYQSHIEMIKRFKIWTYREGEQPLVHLAPLNNIYGIEGQFIDEIEGKMS
SNKFAAHQPDEAHVFFLPFSVANTVDFLYRPLISYNRGPLYRVALDYVNVVVEKYPYWNR
SHGADHFMLSCHDWAPSVSYANPKLFNNLIRALCNANSSEGFLPIRDVSIPEVNIPPRKL
NPSSFGLRISQRNIFAFFAGRTHGHVRKYLFEQWKDKKDEDIRVFEYVPKNLNYFKMLGQ
SKYCLCPSGYEVASPRIVEAIHAECIPVIIKDNYSFPFNDVLDWSKFSIHIPVARIPEIK
TILKGISTRKYLKLVKGVRSVKWHFTLNRPSKPFDLIHMVLHSIWLRRLDIRLPYQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggctaacacaaccacaaaattcttactactaattcctacttttcttctaataatcttc
ttctattcatctttcttgaaccaaaatcacttcaactctaatccgacctctaacaagaag
ctttcggatccgccatcaaatctacccgtaaacattagcaatgaacctaatggtcacgtc
cgtcacaacatctcattttctaccatactagaaaaggaggagaaagagaaggagaaggag
aagaagaagaaaagtagtttggagaagattgaggaagggttggctcgggctcgggcagca
atccgagaagctgcccggagtcggaattatacgtttaaggaacaagtaacaactttcata
ccaagaggatccgtttacaggaatcaacatgctttttatcagagccacatagagatgata
aaaagattcaaaatatggacgtatagagaaggggaacaacccttggtgcatcttgcacct
ttaaacaacatatatggcatagaagggcaattcatcgacgaaatagagggtaagatgagt
tcaaacaagttcgcggctcaccaacctgacgaggcacacgtcttctttcttccttttagt
gtagccaacacggtggatttcctttatcggcccctcatctcctacaaccgtggacctcta
tatagggtggctttggactatgtcaatgtggtggttgagaagtatccttattggaataga
agtcatggagcagatcatttcatgctctcttgccatgattgggcaccaagtgtctcatat
gccaatccaaaattgttcaacaatcttataagagcactttgtaacgccaattcttcagaa
ggattcctaccaataagagatgtctccatcccggaagtgaacataccacctagaaaacta
aatccatcaagcttcgggttgcgaataagccaacgaaacatctttgcatttttcgctggt
cgtactcacgggcatgtaaggaaatacctattcgagcaatggaaggataagaaggatgaa
gacatccgagttttcgagtatgttcccaaaaacctaaactacttcaaaatgttagggcaa
agcaagtattgcttgtgccctagtggttatgaagtcgcaagtccaaggatagttgaagct
atacatgcagaatgtataccagtgattatcaaagataattactctttcccttttaatgat
gttcttgattggagtaaattttcaatccatattccagtggctagaattcctgagattaag
acaattttgaaaggtatttcaactagaaaatatttgaagttggttaaaggagtaaggagt
gtaaagtggcactttacattgaataggccttctaagccatttgatttaattcatatggtg
ttacattctatatggttaaggaggcttgatataagattaccgtatcaataa

DBGET integrated database retrieval system