KEGG   Chenopodium quinoa (quinoa): 110726724Help
Entry
110726724         CDS       T05764                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03040  Spliceosome
cqi04141  Protein processing in endoplasmic reticulum
cqi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110726724
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110726724
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110726724
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cqi01009]
    110726724
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqi03041]
    110726724
   03009 Ribosome biogenesis [BR:cqi03009]
    110726724
   03110 Chaperones and folding catalysts [BR:cqi03110]
    110726724
   04131 Membrane trafficking [BR:cqi04131]
    110726724
   03051 Proteasome [BR:cqi03051]
    110726724
   03029 Mitochondrial biogenesis [BR:cqi03029]
    110726724
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqi04147]
    110726724
Protein phosphatases and associated proteins [BR:cqi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110726724
Spliceosome [BR:cqi03041]
 Complex B
  Other components
   Prp19 complex
    110726724
 Complex C
   Prp19-CDC5 complex
    110726724
Ribosome biogenesis [BR:cqi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110726724
Chaperones and folding catalysts [BR:cqi03110]
 Heat shock proteins
  HSP70 / DNAK
   110726724
Membrane trafficking [BR:cqi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110726724
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110726724
Proteasome [BR:cqi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110726724
Mitochondrial biogenesis [BR:cqi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110726724
Exosome [BR:cqi04147]
 Exosomal proteins
  Proteins found in most exosomes
   110726724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 110726724
NCBI-ProteinID: XP_021761934
Position
Unknown
AA seq 175 aa AA seqDB search
MWRLSGFTCTSKGRGQEGLLGKATKRLIGRSFNDESVLKDIGLWSFKVVACFGSNNEKKP
MVVVNYKGQEKEFSVEEISAMILSKMKETTEAYLGTSVKDAETKDAGIIAGLNVLRIINE
PTAAAFAYGLDNKASGRKNVLIFYLGGGTFDVSLVVVEKESFEVKSVNGDTHLYI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggctaagcggctttacatgcacttccaagggcaggggacaggaaggcctgctt
gggaaagcaacaaaaaggctcataggaaggagcttcaatgatgaaagtgtattaaaagac
atcggactttggtcattcaaagttgttgcttgctttggttcaaataacgagaagaagcca
atggttgtagttaactataaaggccaagagaaggaattttctgtcgaagagatatctgca
atgatcttgtcaaagatgaaggaaactactgaggcctatcttggtacgagtgtcaaggat
gctgaaactaaagatgctggaatcattgctggtctaaatgtgcttcgcattattaatgag
ccaactgcagctgcatttgcttatggtcttgacaataaggcttctggaagaaaaaatgta
ttgattttttatcttggtgggggtacttttgatgtctctttagtcgttgtcgaaaaggag
tcatttgaagtgaaatcggttaatggagacactcatctttatatctaa

DBGET integrated database retrieval system