KEGG   Chenopodium quinoa (quinoa): 110727277Help
Entry
110727277         CDS       T05764                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL7
Organism
cqi  Chenopodium quinoa (quinoa)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH PIP49_C Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 110727277
NCBI-ProteinID: XP_021762536
Position
Unknown
AA seq 325 aa AA seqDB search
MRIKYYALREAEQEKEVKLIHCPTEFQLADILTKALPKSRFEFLRLKLGMMAKSLKEEYV
KSGRVMGRGALSYVFRGRVGFLRTAVAVKRLDKEDKENTKAFCRELMIVSSLERPNVVPL
LGFCIDPEEGLFLVYKYVSSGSLERHLHGKKKSGKGFASLSWSARYKVAVGIAEAIAYLH
NGTEKCIVHRDINPSNIFLSSKKRPKLCDFGLATWTAAPSVPFLCKTVKGTFKYLAPEYF
QHGKVTDKTDVYAFGVVLLEFITGRKPIESSRPSGEENLVQWVCDITLPILLCDRQERAL
NVRFPCPGQMIVPIAELQNKKVADR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaggattaagtattatgcacttagagaagctgagcaagagaaagaagtgaagctgatt
cattgtcctactgagttccagctcgctgacattttgaccaaggctttaccaaaaagcaga
tttgagtttctcagactcaagcttggtatgatggcgaaaagtctcaaggaggagtatgtg
aaatcaggtagagtaatgggcagaggtgcattgagttatgtatttagaggtagagttggg
tttttgagaacagcagtggcagtaaagaggttagataaagaagataaggagaataccaag
gctttttgtagagagttgatgattgtaagttctcttgaacgtccaaacgttgttcctctt
ttgggattttgtattgatccagaggaaggcctgttcttggtttacaaatatgtgtccagt
ggaagcctagagcgacatttgcacggtaagaagaagagtgggaagggtttcgcgtcgctt
tcatggtctgcaaggtataaggttgctgtaggaattgcagaagctattgcatatctacat
aatggaactgaaaaatgtattgttcatagagatataaatccctccaatatttttctatct
tccaagaaaaggccaaagctatgtgatttcggattagcaacatggactgcagcaccatca
gtccctttcctttgcaaaactgtgaaaggaacatttaaatatttggctcctgagtacttc
caacacgggaaggtaaccgataaaactgatgtttatgcctttggagttgtccttttagag
tttataacaggccgaaaaccaatagaatcatcaaggccatccggagaagagaacctggtt
caatgggtatgtgacattaccttgccaatactgttatgtgatagacaagaaagagcactt
aatgtgagatttccatgtccaggacaaatgatagttccaattgctgaactacagaacaaa
aaggtagcggatagataa

DBGET integrated database retrieval system