KEGG   Chenopodium quinoa (quinoa): 110727975Help
Entry
110727975         CDS       T05764                                 

Definition
(RefSeq) glutathione gamma-glutamylcysteinyltransferase 3-like
  KO
K05941  glutathione gamma-glutamylcysteinyltransferase [EC:2.3.2.15]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110727975
Enzymes [BR:cqi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.15  glutathione gamma-glutamylcysteinyltransferase
     110727975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phytochelatin Phytochelatin_C
Motif
Other DBs
NCBI-GeneID: 110727975
NCBI-ProteinID: XP_021763263
Position
Unknown
AA seq 496 aa AA seqDB search
MAAVAGLYRRALPSPPCIEFASKDGKQLFSEALLEGYMEGFFKLVSYYKTQSEPAYCGLA
TLAVVLNALAIDPGRKWKGPWRWFDDSMLDCCEPLEKVKVSGISFNKVACLAHCNGAEVD
TYHTNESTLDNFRNYVISCTSSENCHMIVSYHRSFLKQTGGGHFSPIGGYHAGKDMVLIL
DVARFKYPPHWVPLTLLWDAMNTVDKDTGFYRGFMLLTRFQASSSILYTLSCRHDGWDTI
AKYLSKKLQQLLSSEEIHNIQDILSVILASAPADLSNFINWVAEVRKQENGSNLVSEEEQ
GRLVTKEEVLQQVRETELFKHLTRWFLSGSSCMPKAILDGTDSLEKIASEVCCQGAQLFC
GKVGSCGAISSKTTQLRSSDCDNAKSVTVVSANVVVEDSVCGAEILVPSCQKSPGNPCEC
GLNTSDREHPSVVDGLTVLLLALPPDTWSCLKDAKLLKEFCGIISPKNLPDLLKQEILHL
RKQLYFLVTDVCCSST
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagtggctggactctacagaagggcgcttccttcgccaccttgtattgaattt
gcttctaaggatggcaagcaactcttttctgaagctctcctggaaggatatatggaaggc
tttttcaagttggtttcatactacaagactcaatccgaacctgcatactgtgggttggct
acccttgctgtggtcttaaatgcccttgcaattgaccctggaagaaagtggaaaggtcca
tggagatggtttgatgattctatgttggactgctgtgagccccttgagaaggttaaggtc
agcgggatctcatttaacaaagttgcatgcttggctcattgtaatggagcagaagttgac
acatatcatacaaatgaaagtaccctggacaacttccgaaactatgtaatctcatgtact
tcctcagaaaattgtcacatgatcgtctcataccacagatcatttctgaagcagacagga
ggtggtcatttttctccaattggtggttaccatgctggaaaggatatggttcttattttg
gatgttgctcgattcaagtatcctcctcactgggtacccctcacacttctatgggatgcc
atgaacacggttgataaagatactggattttacagggggtttatgcttctaacaaggttt
caggcatcatcatcaatcctatatactctgagttgtcgtcatgatggctgggacactatt
gctaagtacttgagtaaaaaacttcaacaactcctatcttctgaagaaattcacaatatt
caggatatattatctgttattctggcatcagctcctgctgatctgagtaatttcatcaat
tgggttgctgaagttcgaaaacaggagaatgggagtaatcttgtgagtgaagaggaacag
ggaaggttggttaccaaggaagaggtgttgcagcaagtgcgagagactgagctcttcaaa
cacctaaccagatggtttttatctggatcatcttgcatgcccaaagctattctggatggt
acagattcactagaaaaaattgcttctgaagtatgttgtcaaggtgctcaactgttttgc
ggcaaggttggttcttgcggtgcaataagctctaaaacaacacaattaagatcctctgac
tgtgacaatgctaagtctgtcacggtagtatctgccaatgttgttgtggaagattcagtg
tgtggagcagaaatactggtcccaagctgccaaaagagccctggtaatccttgtgaatgt
ggtttgaatacttctgatagggaacatccatcggtggttgatggtctaactgtactacta
ttggccttgcctcctgatacatggtcttgtcttaaagatgcaaagctcctaaaagaattt
tgtggtataatatcccccaaaaatcttcccgacttactcaaacaggagatactgcatttg
cgaaagcagctgtatttccttgtgactgatgtctgctgttcttcgacgtga

DBGET integrated database retrieval system