KEGG   Chenopodium quinoa (quinoa): 110728401Help
Entry
110728401         CDS       T05764                                 

Definition
(RefSeq) separase-like
  KO
K02365  separase [EC:3.4.22.49]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqi01002]
    110728401
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cqi03036]
    110728401
Enzymes [BR:cqi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     110728401
Peptidases and inhibitors [BR:cqi01002]
 Cysteine peptidases
  Family C50: separase family
   110728401
Chromosome and associated proteins [BR:cqi03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    110728401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 110728401
NCBI-ProteinID: XP_021763754
Position
Unknown
AA seq 2124 aa AA seqDB search
MDEQTQASSLLSKLETYEFAEIYTHFSEFLQPFSLLNSTKPQNPSKKPSRSKKPSQSSPS
SSIRSLAKTFLPFVNRSLSLLPKRLSESPKHPKTGEFVAQLLDCYKLCLDCLDVLSSELS
GKLYCVHLQRGRYVHCLIRWERYGDAINEGFRVLKDIGGVKLEGPGWKVSKGELVPRLIV
VDGDNNGGVEEDIVHLVVDLVVAVAQSVSLSKVKDAGKYTGLLILHDEARPWFRHLETSV
CSKLQWKLLAHMKNVALFLVREVTHFNGDLVPDFCAAVFNEYTQLLNAQCIQGTTMEEQE
EFVKFVSNCTSKCRSACKNVRVSVAMHLYRSADNFSQGFLYFLLIQRFHALGLYFYELCF
ESNNCMSSTSGGSTGTHSVGFFPNDWDKLKDLSCLLSNGKKYYPSHLEVYDNPLSHDFRD
YVENASISSRADCKISKSFKSTNGEENLSFYLNALKFLCWPLADFVTSERKRIVVEDTES
PLGDALKLILEAFLEYSYLFPHCQQNSESRVEIDMIVLNISVACFTLSLKLNLITEGSTR
LVNYILSDKCTSLLRPHMLKYIIAMLHNNFVEFYRHEQFKEAFDALELCSRASWNRCLLL
CEIHVGKQKGVDGVVSENMIAESVNEACKVGSLLMDIDHRIDSGKVEKAIDSGLVKWCLA
KNLLGQLPCPVTLIKHWAKVQCKLYKNTKDDAPILGYNLLQSPCLAKNNISSEIVGTVLE
QELSAYHEMSNLYPIFCQRMQMKLIDTLLKKLYISSKCLQRSTILVKKGLLLRTFGIENL
DNCICCLSKAIESVNGMSGDKVYNQLAVLYCLRALSSHEADPTSKDMFRDINEAVDLWLT
TIDVLCCSSSGNCEMGCEYVLQLLYHIADLLSIKGDATLHAKVLSVIMKVCKQLNVPLEK
CLSLLWESRRVNHALCAVPVNEAFIEALSKHYGKEAESLEFWIGSFKDSQPLLVGLQQNF
SFLSSLFPLAFYQHKHSLQSEISVDEVKKIASNLLSNVSVSRSSAFLAGYLYHDLSEWLC
AGGRIIEAFFYAKEAHRLRGKLLQEHFSCSIQQNDENQGESIRKSSAIVSQLSVLNQIAI
RAWPAKSVAPSLDSSSLTPWNVLRCYLESTLQVGIIHERLGNVAEAEAQFILGKSISCLQ
CLPRFIFRFSSCLGKIYHGMGLLDFASTELSVQNLDVERNSLTCSRCLLMLESDINELGN
LRRKVVNCAPGNPYESSILSLLSLEGASVAHSVHECDAAISGVDTISRPTKAKAKVEAKR
SRKTKKELETQVTANSCVAEQNKRVTRSRKLSPNAKSAAFVKDGKNVTTCQTNGQLETEE
AIVSKKISCQKCFSSELNLFGSLACFTQMKWEFVRRQQILRLLIELGKRQGALAGTHRLH
TVYSKCIFILLGGNDCHCSSCTVLDFDSISKEIAGDILVSERAEVLYNICLLSLKALYSE
DIRTACFPFCCIQMSHVISFLKLSFVLSREIPLLFQKVSRLLALVYVVSASKKNFSSLIS
CKVLSESYWAAYFHQASVGSHHDLQLLSAISLKHKSQLVSKNEGYEAADATSVTDTCKLL
RIVPESTKDMESCVAKFFENLPSTTIVCVSILGASYASLLKELMCYPSTVYGWMLLSHFN
ADSQPAVIMLPLSTVIQEEEPDTSCSIFGEKNVLKEWCSPWGSNALVDDIAPLFKLILRG
NYLSCSSFPEEHTEKSRELWWTLRDNLDKCLHKLLRDIEEKWLGQWKYLLLGQWLDTDPL
KCAVKEFMDNTRKDGCILDINESIVKIVIGGIKSINTEKLKIPKLFLEKGCFIGSITDSV
RGLDKEYDGVDYVSDLLIAAANQIELEYCSRREPVVLVLDSDIQMLPWESIPIMREQEVY
RMPSVASIFMALQRRSVLQESARLGTKFPLIDPLDAFYLLNPSGDLSRTQSEFEEWFRYQ
NMQGKAGAVPSTEELSAALENHDLFLYFGHGSGAQYMPRDKIQKLESCSALLLMGCSSGS
LNLNGCYAPVGTSLSYMLAGAPIVVANLWEVTDLDIDRFAKAVLKSFFEERSMSSTDCIQ
CSLLAEELESMSVNERKRNPKKGRGKKKAVDPVPDVSGEYCYKHKLRAGYFVSQARKACK
LPFLIGAAPVCYGVPTGIKKKRDI
NT seq 6375 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacaaactcaagcttcatctctcctctccaagctcgaaacctacgaattcgcc
gaaatctacactcatttctccgaattcctgcaaccattctctcttctcaattccaccaaa
cctcaaaaccctagcaaaaaaccctctcgcagcaaaaaaccctcacaatcttccccttct
tcgtcaattaggtcacttgcgaagacatttctacctttcgttaatcggtctctttctctc
ctcccgaaacggctctccgaatctccaaaacatccgaaaactggcgaatttgtggctcaa
ttgctcgattgttacaaattgtgcttagattgtttggatgttttatcgtccgagctttcg
ggtaagctgtattgtgtgcatttgcagagaggtaggtatgtacattgtttgattaggtgg
gagaggtatggggatgctatcaatgaaggttttagggttttgaaggacattggaggggtt
aagcttgaagggcctggatggaaggtttcgaaaggagagctcgttcctaggttaatcgtt
gtcgatggcgataataatggaggagtggaggaggatattgtgcacctagttgtggatttg
gttgttgctgttgcacagtctgtatcgttgagtaaagttaaagatgctgggaagtatact
ggtttgttgattttgcacgacgaggctcgcccgtggttcaggcatctggaaactagtgta
tgcagtaagctgcaatggaagctattagctcacatgaagaatgttgcgctgtttttggtt
agagaagttacacattttaatggggatttggtacctgatttctgtgctgctgtattcaac
gagtatacacaattattgaatgctcaatgtatccaggggacaacaatggaggaacaagaa
gaatttgtaaaatttgtatcaaattgtacatccaaatgtcggtcagcatgcaagaatgtt
cgggtctccgttgctatgcatttgtacagatctgcagacaatttttctcagggtttttta
tacttcttacttattcagagatttcatgctttggggctatacttctatgagttatgtttt
gaatcaaacaattgtatgtcttcgacttcagggggctcaacaggtactcattctgtggga
ttttttcccaatgattgggataagctaaaagatttatcatgtttgctgagtaatggcaag
aaatactacccttctcacttagaggtctatgacaacccgctaagtcatgatttcagggat
tatgttgagaatgcatctataagttctagagctgattgtaagatttctaaatcctttaag
tcaacaaatggggaagaaaatctatctttttatctgaatgccttgaagttcctatgttgg
ccacttgctgactttgtaacttcagaaagaaaaaggatagttgtggaagacacagaatcc
cccctaggagatgcattgaagcttatcctggaggcattccttgaatacagctacctcttt
cctcattgtcagcagaatagcgaatctcgtgttgaaattgacatgattgtgcttaacatc
tctgtggcttgttttactctctccctgaagctaaatctcatcaccgagggaagtacaagg
cttgtaaattatattctctctgataagtgtacttcattgttacggcctcacatgctgaag
tacatcatagccatgcttcacaacaattttgtcgaattctacagacatgaacaatttaaa
gaggcctttgatgctttagaattatgttctagagcatcatggaatcgctgtttacttctg
tgcgagatacatgtgggcaagcagaagggagttgatggagtggtatcggaaaatatgatt
gctgagtctgtgaatgaggcatgcaaagttggttctcttcttatggacattgaccatcgt
attgatagcggtaaagtggagaaggcaatagatagcggacttgtaaagtggtgccttgcc
aaaaaccttttagggcagctcccttgtcctgtgacattgataaaacactgggctaaggta
cagtgtaagttgtataagaataccaaagatgatgctccaatcttgggttataatctcctc
caatctccttgcttggcaaaaaacaatatttcatctgaaattgttgggaccgttttagag
caggaactttcagcttaccatgagatgagcaacttgtatcctatattttgtcagagaatg
caaatgaaattaattgacaccctcttgaagaaattgtatatatctagcaagtgcttgcag
agatcgactattctagtcaagaaaggattgttattaaggacctttggaattgaaaatctg
gacaattgtatctgttgtttgtcaaaagcaattgaatcagttaatggcatgtctggtgat
aaggtgtataatcagttagctgttctgtattgtttgcgtgcgctttccagtcatgaagct
gacccaacatcaaaggatatgtttagagatatcaatgaagctgtagacctatggttgacg
actattgatgttctttgttgctcttctagtggcaattgtgagatgggatgtgagtatgtg
ttgcagcttctatatcacattgctgacttattatccatcaagggcgatgcaactcttcat
gcaaaagtactatctgtaatcatgaaagtgtgtaaacagttgaatgtcccactggagaag
tgtctgtcactattgtgggagtcgcgaagggttaaccatgcactatgtgctgtacccgtt
aatgaggcattcatcgaggctctttcaaaacattatggtaaagaggcggagtctcttgaa
ttctggattggtagttttaaagattcccagccgctattagtagggcttcagcaaaatttc
tcgtttttgtcctctcttttcccccttgctttctatcaacacaagcattctttacagtcc
gagatctctgttgatgaagtgaaaaaaattgcatcgaaccttctttcaaatgtttctgta
tctcgtagctctgcttttctagctggatatttataccatgatttgagtgaatggctttgt
gctggtggaaggattattgaggcatttttttatgcaaaagaagctcatcggttgcgtggt
aagctgttgcaagagcatttttcttgctcaattcaacaaaatgatgaaaaccaaggggaa
tctataaggaaatcatcagctattgttagtcagctctctgtgttgaatcaaatagctatt
agagcttggcccgctaaatctgttgcaccgtctttagacagctcttctcttaccccttgg
aatgtgcttcgctgttatcttgagagcacgctgcaggttggtataatccatgaaagactt
ggaaatgttgctgaggcagaagctcagtttatattaggcaagagtatctcctgcttgcag
tgcctgccccggttcattttcagattttcctcttgtttagggaaaatataccatggtatg
ggccttttggacttcgcatccacagaattatcagtgcaaaatttggatgttgaaaggaac
tctctgacttgctcaaggtgtttactcatgttggaaagtgatataaatgaacttggtaat
ttgcgtagaaaagttgtcaattgtgctccaggaaatccttatgaatcatctattctaagt
ctgttatcacttgagggagccagtgtagcacactctgtgcatgaatgtgatgctgctatt
tcaggcgttgacactatatcaaggcctacaaaagcaaaagctaaagtggaagctaaaagg
tctaggaagacaaaaaaggaactagaaactcaggtaactgctaattcctgtgtagctgag
cagaataaaagggtaactcgttctagaaagctgtctcctaatgccaaaagcgctgccttt
gtcaaagacggaaagaatgttacaacttgccagaccaatggccagctggaaactgaagaa
gcgattgtttctaagaaaatttcatgccagaaatgtttttcaagcgaacttaatttattt
ggttctctagcttgttttactcaaatgaagtgggagtttgtacgccggcaacaaatactg
agactactcattgaattagggaagcgtcagggagctttggctggaactcatagattgcac
actgtatactctaaatgcatatttatattgctgggaggaaatgattgtcattgttcaagc
tgtactgttctagattttgattctatcagcaaggagattgctggagatattttggttagc
gaacgtgcagaagtgttgtacaatatttgtttgctttccttgaaagctttgtattctgag
gacatcaggactgcttgttttcctttttgctgcatccaaatgtctcatgtaatatcattc
ctaaagctatcgtttgtgctgagtcgtgagattcctttgctctttcagaaggtgtcgaga
ctgcttgctttggtttatgtggtttcagcttccaagaagaacttctcttcccttatatct
tgcaaagtgctttcagaaagttattgggctgcttattttcatcaagcctcagttggatct
catcatgatttgcagttactttcagccatttccttgaagcataaatcccagttggtatcc
aaaaatgagggttatgaagctgctgatgcgacaagcgtaacagatacttgcaagttgctt
aggattgttcctgaatcaacaaaagatatggaatcatgtgtggcaaagttttttgaaaac
cttcccagtaccacaatagtatgtgtgagcatactaggggcttcttatgcgagcctttta
aaagaattgatgtgttatccttctactgtttatggttggatgcttttgtcccattttaat
gctgacagtcagccagctgtgataatgttacctctaagtactgttatccaagaagaagaa
ccggatactagctgctcaatctttggtgagaagaatgtactgaaggaatggtgctcacca
tggggctccaatgccctggttgatgacatagctcctttgtttaaattgattttgcgagga
aattacttatcttgctcaagctttcctgaagaacacactgaaaaaagccgtgaactatgg
tggactttgagagataaccttgataagtgcctgcataagttactgcgggatatagaagaa
aaatggcttggtcagtggaaatacttgcttctgggtcaatggttggacactgaccccctt
aagtgtgccgtgaaggagttcatggataataccagaaaagatggatgtatattggatata
aatgaaagtatagtaaagatagttataggaggcatcaagtctattaatacggaaaaattg
aaaatcccgaagttgttccttgagaaaggctgtttcattggaagcatcacagattctgtt
cgaggactggataaggaatatgatggtgttgattatgtatcagatttactcattgctgca
gctaaccagattgagttagaatactgcagccgcagggaacctgttgttcttgtactagac
agcgacattcagatgcttccttgggagagcattcctattatgagggagcaagaggtgtat
cgcatgccctctgttgcaagtatcttcatggctctgcaaaggaggtctgtcttacaggaa
tctgctaggcttggtaccaaatttccattgatagatccactggatgctttttatctcctg
aatccgagtggtgacctaagtcgcacacaatctgaattcgaggagtggtttagatatcaa
aacatgcagggaaaggcaggagctgtcccgtcaactgaagagttgagtgcagcattggag
aaccatgatctattcctatattttggccatggaagtggtgcacaatatatgcccagagac
aagatccaaaaactagaaagctgctctgctctgcttcttatgggatgcagcagcggatct
ttgaacttgaacgggtgctatgctccagtcggtacttctctctcgtatatgctagctggc
gctcctatcgtggttgctaacctgtgggaagtgacagacttggacattgaccggtttgct
aaagctgtgcttaaatctttttttgaagaaagatcaatgtcttccacagactgcattcaa
tgcagtttattagccgaagaattggagtctatgagcgtaaatgaaaggaaaagaaaccct
aagaaaggccgaggaaagaagaaagcagttgatcctgtgcctgatgtttcaggtgaatat
tgctacaaacataagttaagggctggatattttgtcagtcaagctcgaaaagcatgtaaa
cttcccttcctgattggagctgcacctgtttgttatggtgttcctacaggtataaagaaa
aagagagatatttag

DBGET integrated database retrieval system