KEGG   Chenopodium quinoa (quinoa): 110728922Help
Entry
110728922         CDS       T05764                                 

Definition
(RefSeq) cytochrome P450 94A1-like
  KO
K20769  fatty acid omega-hydroxylase [EC:1.14.-.-]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    110728922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cqi00199]
    110728922
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     110728922
Cytochrome P450 [BR:cqi00199]
 Cytochrome P450, plant type
  CYP94 family
   110728922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 110728922
NCBI-ProteinID: XP_021764277
Position
Unknown
AA seq 522 aa AA seqDB search
MFELGKLLSPFLLIFPLLLLYFTKRFLSTQTPKTCQTTSFEFPKAYPLIGHLIAVLKQKK
DERFRWIASLIVNSPSSTFVFHRLLGHQSILTGNPATVEHMLKNQFSIYQKGPFQKAILK
DLLGDGIFNVDGEMWKFQRQVASYEFNTRSLRKFVETVVDAELSDRLIPLLSDAAKNKTV
LDFQDILQRFAFDNICKIAFGYDPEYLSPSLPKAKFAVAFEDAVTISSQRFRSFFPILWK
IRRFLNIGSEKELKEAVTEIRNFAKTIVRQKKRGEVKDSESSEPEDLLSRFLKSGHTDEK
FVTDIVISFILAGRDTTSSALTWFYWILHKNKHVEEEILREINKNRGKQKNKTEHSSLFD
EVKVMVYTHAALCESMRLYPPVALDTKEAANNDVLPDGTKVKKGNWVAYSAYAMGRMEGI
WGLDWSEYRPERWLEVEDEKMGAGKWKFVPRDPYSYPVFHAGPRVCLGKEMAFLQMKMVV
AGILERFRVVPAVEERIEPVYVANLTAKMQGGFPVRIEERTV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcttgggaagttgttaagcccgtttttgctgatcttcccattgcttctcttg
tacttcaccaagaggtttttatccacccaaacaccaaaaacctgccaaactactagtttt
gagttccccaaagcttaccctttgattggccatttgatcgcggtcttgaagcaaaagaag
gatgaaagattcaggtggatcgctagtctgatagtcaactctccatcgtccacctttgtc
ttccatcgtctgcttggacatcagagcatccttacaggaaaccctgccacggtggagcac
atgctcaagaatcagttttcaatttaccaaaagggtcctttccaaaaggccattctcaaa
gacctcttaggtgatggcatattcaatgttgatggtgagatgtggaagtttcaaagacaa
gttgctagttatgaattcaacaccaggtccttgcggaagtttgttgaaacagtggttgat
gccgagctttcagacaggctgatcccgttgttatctgatgcagccaagaacaaaacagtc
ctagatttccaagacatactccaaaggtttgcatttgataatatttgcaagattgctttt
gggtatgatccagaatacttgtcaccctctttaccaaaagcaaaatttgcagttgcattt
gaggatgctgtgacgatcagtagccaaagattcagatcttttttcccaattctatggaaa
atacgcagatttctcaatattgggtcagaaaaggagcttaaagaagcagtcacagagatc
cggaactttgccaaaactattgttagacagaaaaagcgaggggaggtgaaagattcagag
tcatcagaaccagaagacttattgtcaaggtttctaaaatcaggccataccgatgagaaa
ttcgtgactgacatcgtgattagctttatccttgcaggacgagacaccacatcatcagct
ttaacatggttttactggatcctccataagaacaaacatgttgaagaagagatcttacga
gagatcaacaaaaacaggggaaaacagaaaaataaaacagaacattcctctctttttgat
gaagtcaaagtcatggtttacactcacgctgcattatgcgagagcatgaggctataccca
ccagtggcattagacaccaaggaggctgccaacaatgacgtgttgccagatggcacgaaa
gttaaaaagggtaattgggtagcttacagcgcttatgctatgggtagaatggaaggtata
tggggccttgattggtctgaataccggccagagcggtggctagaagtggaagatgaaaag
atgggggcagggaagtggaagtttgtgcctcgagacccatactcttacccagtttttcat
gctggccctcgggtttgccttgggaaagagatggcatttttgcaaatgaagatggtggtg
gctggtatcttggagaggtttcgagttgttccagcagtggaagagagaattgagccagtt
tatgttgcaaatttgacagctaagatgcaaggtggtttcccagtaaggattgaagaaagg
actgtataa

DBGET integrated database retrieval system