KEGG   Chenopodium quinoa (quinoa): 110729235Help
Entry
110729235         CDS       T05764                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00906  Carotenoid biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Module
cqi_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    110729235
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     110729235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 110729235
NCBI-ProteinID: XP_021764642
Position
Unknown
AA seq 601 aa AA seqDB search
MATASSSNWVLPKPKIGSSKKSKSQFNLVNSSLQLPLLDSPKKASSSSTTTQTPKKITTF
PKEVRDPFFTSPKDNNNIFSKPHPKQWNPFQKAAAAALDMVEKALNSHESEQPLPKTSDP
RVQLAGNFAPVPEQPVQQNLLVTGAIPECIRGVYVRNGANPLYEPVSGHHFFDGDGMIHA
VKFHSDGSASYSCRFTETNRFVQERALGRPIFPKAIGELHGHTGIGRLVLFYSRAMFGLL
DQNNGIGVANAGVVYFNDRLLAMSEDDLPYQVKVTSSGDLETVGRYDFNGQLKSTMIAHP
KVDPVSGEMFALSYDVVKKPYLKYFWFAADGTKSPDVEIDLGSATMMHDFAITENNIVIP
DSQVVFKLQEMIGGGSPVVFDKEKTARFGILPKYAKNADEIQWIDVPDCFCFHLWNAWEE
PETDEVVVIGSCMTPADSIFNESDENLSSVLSEIRLNRKTGISTRREILPSSEKMNLEAG
MVNRNNLGRKTQFAYLAIAEPWPKVSGFAKVDLFTGEVKKFMYGDDKYGGEPLFLPRNAD
SESEDDGYILAFVHDEMNWTSELQIVNATDLELVATVKLPSRVPYGFHGTFIHANDLQRQ
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgctagtagtagcaattgggtgttaccaaaaccaaaaattggttcatcaaaa
aaatcaaaatcccaatttaatttggtaaattcttcacttcaattacctttactagactct
ccaaagaaagcttcatcttctagtacaacaacccaaacgcccaagaaaattaccactttt
cctaaggaagttagggacccttttttcacatcaccaaaagataacaataatatattttcc
aaaccgcatccaaaacaatggaatcccttccaaaaggcggccgcggcggccttggatatg
gttgagaaagccttgaactctcatgagagtgaacaacctttgcctaaaacctccgacccg
agagtccaactagctggaaacttcgctccggttccggaacagcctgttcagcagaacctt
ctggtaaccggagcgattccggaatgtatccggggagtatatgtacgaaacggggcaaac
ccgttgtacgagccggtttccggtcatcatttctttgacggtgatggtatgatccacgcc
gtcaagtttcattcagatggttcagcaagttactcctgccggtttactgagactaatcgg
tttgtccaagaacgtgctttgggtagacccatttttcccaaggcaattggtgaacttcat
ggtcataccggtattggaagacttgtattattctattctcgtgcaatgtttggtctttta
gatcaaaataacggtataggggttgccaatgccggagttgtttacttcaatgacagacta
ctagctatgtccgaagacgaccttccttatcaagttaaggttacttcttcaggagacttg
gaaactgttggtcgttacgactttaatggacagctgaagtctactatgattgcgcatcct
aaggtagacccggtttccggcgaaatgtttgctttgagctatgatgttgtcaagaaaccg
tatttgaagtatttctggttcgcggctgatggtacgaaatctcctgacgttgagattgac
cttggatccgccactatgatgcacgatttcgcaatcacggagaataacatcgtgatacct
gactctcaggttgtgttcaagcttcaggagatgattggaggcggttctcctgttgttttt
gacaaggagaaaactgcgcggtttggaattttaccaaagtatgcaaaaaacgctgatgaa
attcagtggattgatgtacccgattgcttctgctttcatctgtggaatgcgtgggaggag
cccgaaaccgacgaggtggttgtgatcggatcctgcatgactcccgcagactccattttc
aacgagtctgacgagaatctctccagtgtattatcagaaatcagactgaaccggaaaacc
ggaatctcaacacgccgcgaaatcctcccaagttcagagaaaatgaacctggaggccggt
atggtgaacagaaataacctcgggcggaaaacccagtttgcgtacctcgccattgctgag
ccatggccgaaggtatctgggttcgccaaggttgacttattcaccggagaagtcaagaaa
ttcatgtacggagatgacaagtacggcggcgagcctctgtttcttcctaggaatgctgat
tccgaaagcgaagacgacggttacattctcgcatttgttcatgacgagatgaactggaca
tcagagttacagattgtcaatgccacagatttagagctggttgcgacagtcaagcttccg
tcaagggttccttatgggttccacggtactttcatccatgctaacgatttacaaaggcaa
gcttaa

DBGET integrated database retrieval system