KEGG   Chenopodium quinoa (quinoa): 110734435Help
Entry
110734435         CDS       T05764                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP63-like
  KO
K09566  peptidyl-prolyl isomerase G (cyclophilin G) [EC:5.2.1.8]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqi03041]
    110734435
   03110 Chaperones and folding catalysts [BR:cqi03110]
    110734435
Enzymes [BR:cqi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110734435
Spliceosome [BR:cqi03041]
 Complex C
  Other components
   PPlases
    110734435
Chaperones and folding catalysts [BR:cqi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110734435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 110734435
NCBI-ProteinID: XP_021770282
Position
Unknown
AA seq 667 aa AA seqDB search
MAKKKNPQVFLDVSIGGDPVQRIVIELYADVVPKTAENFRALCTGEKGVGATTGKLLHFK
GSNFHRIIKGFMAQGGDFSKGDGTGGESIYGGKFADENFKLEHSEPGLLSMANCGRDTNG
SQFFITFKRTPHLDGKHVIFGKVVEGMDVVKKMEQFGTSEGRPIEQVKIVDCGEVSSGKK
ETAVRTEKGKVKKMKKLPSSDDSSDGKARGRHRRFPKDRRRKKRKYSSSDSYSSSSSDQS
DSDSDSYTSDSDSGSESDASLSDSSSSSDDRRRKRKRSSKGPKRVRKKSRGSSKKSRRNG
KKSRRKSNRSSESSSDSETTSGSEEEKSRHRDSSKLKKKSSMSIEEQQQKAHVQKAEVES
EFSRRTEHISNNANGREMKSEKLKESSYDGSREKPRSQSPSPKKIQEISPRRDTSLSPYK
GHDGSPEPQHENKVPAEEPVLPLASAQNQEVSKSTPENDNGEPKRLRKGRGFTEKFAFAR
RYRTPSPERSPRRPFNYGGRNYYDRNRDRFSSYRGGSDRSPRRRYRSPPRRRSPRRSRSP
SHSPNDTRGPRRNRSRSPAHGSSLRRDRSRSPVRGSSPKERRPEISDRLRSRLGPRADNQ
RSPVKARSRPRSRSRGRSSSRSSSPNDGSLKHRKRGSASPTKSTSSSPVGQKGLVAYGDA
SPDAAST
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaaaaaaaccctcaagtgtttttagatgtatcaattggtggggatcctgtc
caaagaattgttattgagctttatgcagatgttgttcctaaaactgcagaaaatttccga
gcactctgcacaggcgaaaaaggtgtgggagctactacagggaaactattgcacttcaag
ggatcaaattttcaccgcataatcaaaggatttatggcccaagggggtgatttttcaaag
ggagatggcactggtggagaaagtatctatggtggcaagtttgcagatgagaatttcaaa
ttggagcatagtgaacctggacttctctctatggcaaattgtggtcgtgataccaatgga
tcccagttttttataaccttcaagcgtacacctcatcttgatgggaagcatgttattttt
ggaaaggttgtggagggaatggatgttgtgaagaaaatggaacagtttggaacttctgag
ggacggcctattgagcaagtcaaaatagttgattgtggcgaagtttcctctggtaaaaaa
gaaactgcagttaggactgagaaaggtaaagttaaaaaaatgaaaaaacttccaagttct
gatgatagttcagatggcaaagctagaggacgacataggagatttccaaaagacaggagg
agaaagaagaggaaatactcttcatctgactcatatagtagctcgtcatctgatcaatct
gattcagattccgattcctacacttcagactcagattctggttcagaatccgatgcctcc
ttatctgactccagctcatccagtgatgataggcgccggaagagaaagagatcttcaaaa
ggcccgaagcgggtgcggaaaaagagtagggggagcagcaagaaaagtcgacgtaatggg
aagaaatctagacgaaagtctaaccggagttctgaaagctccagtgacagtgaaacgact
agtggctctgaggaagaaaagtctagacatcgcgattcttcaaagttgaagaagaaatct
tccatgtctattgaggaacaacaacaaaaggctcatgtgcagaaagcagaggtggagagt
gaattttctcgaaggactgaacatatttcaaacaatgcaaatggcagggaaatgaagtct
gagaaacttaaagagtcatcctatgatggaagcagagagaaacctaggtcccagtctcct
agtccaaagaaaattcaagaaattagcccaaggcgagacactagtttaagcccctataaa
gggcatgatgggagtcctgaaccacagcatgagaataaagttcctgccgaggagcctgtt
ttacctctggcttctgctcagaatcaagaagtgtcaaaatctacgcctgaaaatgataat
ggtgaacctaagcgccttagaaagggacgaggattcactgagaagttcgcctttgcacgc
cgatacagaaccccttctccagagcgctcacctcgtaggccattcaattatggtggtagg
aattattatgacaggaaccgtgataggttttcgagctacagaggtggatcagatcgttca
cctcgccgtcgttacaggagccctccaagaagaagatcccctaggaggagtcgaagtcct
tcccacagtccaaatgacacacgtggacccaggcggaatcggagccggagtccagcacat
ggttccagtctaaggcgggataggagccggagtccagttcgtggctccagtccaaaggag
agacgcccagaaatcagtgataggctaagatctcgtcttggcccccgagcagataatcaa
cgttctccagtaaaagcaagatcaagacctagatcaaggtccaggggacgcagctcatcc
cgttcaagctcacccaatgatggttcacttaagcaccggaagagagggtctgcatctcct
accaagtcaacctcaagctcacctgtcgggcagaaaggtctggtagcctatggagatgct
agccctgatgctgcatcaacatag

DBGET integrated database retrieval system