KEGG   Chenopodium quinoa (quinoa): 110735590Help
Entry
110735590         CDS       T05764                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqi01001]
    110735590
   01009 Protein phosphatases and associated proteins [BR:cqi01009]
    110735590
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110735590
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: Other
  Wnk family
   110735590
Protein phosphatases and associated proteins [BR:cqi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110735590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 110735590
NCBI-ProteinID: XP_021771471
Position
Unknown
AA seq 300 aa AA seqDB search
MPAWSSSSSSSSSESSDTDDYSVVVEHCPRGRYVRYNSTIAKGATETVYKGFDKLSGKEI
AWCKTTELTDDELIHKLYTCTLLQQSLDHENVIKCYKCWRDRSSAKILNIITESFTSDLR
DYIDKHTLVHISTAIKIWCRQILNALYYLHNRTIPMIHHDVKIDNIFVIGELGMVKLGYF
GHAFPFRRVRRGTCDAGISETMAPDVFEQDYTEKIDVYSLGMTVLQIVTKEKLYSVCNDN
TEMVCEMIKNCKLPAALNDVRDLYIRRFIDKCISPVSERPATIELLKDGFLANGTMFLKD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcttggagctcttcgagttcttcgagttcatcagaatcatcagacacagacgat
tacagtgttgtggtggagcactgtccgagagggcgatacgtaaggtacaacagtaccata
gccaaaggtgccacggaaacagtttataaggggttcgataagctttctggtaaagaaatc
gcttggtgtaagacaacggagttgacagacgacgaattgattcacaaattatatacatgt
actctgttacagcagtcactagaccatgagaatgtaattaaatgctacaaatgttggcga
gatcgttcaagtgctaaaatccttaacatcattaccgagtcttttacctccgatttgaga
gattacatcgacaaacatactcttgtgcatattagtactgcgatcaagatttggtgtcga
cagattttaaatgcgttgtattatcttcacaatcgtactataccgatgattcatcatgat
gtcaagattgacaacatctttgttattggagagttgggcatggttaagcttggatatttt
ggtcacgcatttccatttcgacgtgtgagaaggggtacttgcgatgctggtatatcagaa
actatggcacctgatgttttcgagcaagattatactgagaagattgatgtatactcgctt
gggatgactgtattacagatagtgactaaggaaaagctgtacagcgtatgcaatgataac
acggaaatggtttgcgaaatgattaagaattgtaaactacctgctgcgctgaatgatgtc
agagacttatatattaggagattcattgataagtgtataagtcctgtttctgagagaccc
gcgacaattgaacttctgaaggacggatttcttgcaaacgggacgatgttcctgaaagat
tga

DBGET integrated database retrieval system