KEGG   Chenopodium quinoa (quinoa): 110735647Help
Entry
110735647         CDS       T05764                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A-like
  KO
K03254  translation initiation factor 3 subunit A
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110735647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cqi03012]
    110735647
Translation factors [BR:cqi03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    110735647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 110735647
NCBI-ProteinID: XP_021771527
Position
Unknown
AA seq 939 aa AA seqDB search
MSTFAKPENALKRAEELINVGQKQDALQALHDLITSKRYRAWQKTLEKIMFKYIDLCVEM
RKGRYAKDGLIQYRIVCQQVNVNSLEEVIKHFMHLSTEKAELARNQAQEALEEALDVEDL
EADKRPEDLMLSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLENLYAMTA
HRAFQFCKQYKRTTEFRRLCEIIRNHLSNLNKYKDQRDRPDLTAPESLQLYLDTRFEQLK
IATELELWQEAFRSVEDIHGLMCMVKKTPKPSLMVVYYAKLTEIFWISGSHLYHAYAWLK
LFLLQKNFNKNLSQKDLQTIASSVVLAALSVPPYDHKRGASHLELENEKERNMRMSNLIN
FNLDSKPESREVLSRSALLLELVSKGVMSCVLPEVKDLYHLLEHEFLPLDLSLKVQPLLN
KISKLGGKLASASSVPEVQLSKYSLALEKLATLRLLQQASQVYQTMTIESLSQMIPFFDF
SAVEKISVDAVKHRFINMKVDHMNGAVSFNILDLESDTLRNHLTVLAESLNKARSMIYPP
LNRASKIGDSLPGLAEVVEKEHKKLLARKTIIEQRKEEQERQLLEKEREEELKRLQQQKN
NEEAEQKRLAIELEKRKIQRIQKEIEEREKEETKALIQEKFSKNKKKPLIEGDNLTKQQL
MELALNEQLKEKQEMEKKLQKLSKQMDYFERAKREEAAPLIESAYQQRLVEEQLLHEREQ
QLEVELSRQRHDGDLQEKNRLARVMENKKIFQERVVSHRQSEFERLRQEREEHFHQIREA
RKQERVAQRKMLFYLRSEEEKLNRLREEEDARKREEAERRRKEDAEHQAKLDEIAEKQRQ
RERELEEKERLRRQKILAGEAARSSEASPLARPQAEAVPASAAASSAAPAAAAAAPAPTR
YVPRHLRENAAVPAPAPTADRWRSTDRRGSGGGSSRPTW
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctttgcgaaaccagaaaatgctttgaagcgagcggaagagctgatcaatgtt
ggtcagaagcaagatgccctgcaggctcttcatgaccttattacctccaaaaggtacaga
gcatggcaaaaaacgttggaaaagatcatgttcaaatacatagatctctgtgttgaaatg
aggaagggtaggtatgccaaagacggtttaatccaatatcgaattgtatgccaacaagtg
aatgtgaattctttagaggaagtaattaagcatttcatgcacttatcaactgagaaagct
gagcttgctcgtaatcaagctcaagaagcattagaagaagcacttgatgttgaagatctt
gaggcagataagcgtcctgaggatctaatgctaagctatgttagcggagagaagggaaaa
gacaggtctgaccgtgaacttgttacaccttggttcaaatttttgtgggagacatacaga
actgttttggaaatattacgtaataattcaaaattggagaatctttatgcaatgacagca
catcgcgcttttcaattctgcaagcaatacaaacggactacagaatttcgaagactctgt
gaaataatccgaaaccatttgtcaaatttgaataaatacaaagaccaacgagacaggcct
gatctgacagctccagaaagcctgcaattgtatcttgacacgagatttgagcaactaaag
attgccactgaacttgaactttggcaggaagcatttcgctcggttgaagatatccatggc
ttgatgtgtatggttaagaagacacctaagccttcgttgatggttgtttactatgccaag
ctcactgaaatattttggatttctggtagccatctgtatcatgcatatgcttggctcaag
cttttcttgcttcagaagaactttaacaagaacttaagccaaaaggatttgcagacgata
gcatcatctgtggttttggctgccctctctgttcctccttatgaccataagcgtggtgca
tctcatttggaacttgaaaatgagaaagagcgtaatatgaggatgtctaatcttattaat
tttaatcttgattccaaacccgagagcagagaagtgctctcacgctcagctcttcttttg
gaactggtttccaaaggtgttatgtcttgtgtacttccagaagtgaaagatctttatcat
cttctagagcacgagtttctccccttggatttgtctctaaaagttcagcccttgttgaac
aaaatttctaagcttggtgggaaacttgcttcagcttcttctgtaccagaagtgcaattg
tcaaagtatagtcttgccttggaaaagctagcaactctgagattgctacagcaggcttcc
caagtataccagacaatgactattgagagtttatcccaaatgattccattttttgatttt
tctgctgtggaaaagatctctgtagatgctgttaaacataggtttataaatatgaaggtt
gatcatatgaatggtgctgtttcgtttaatattctggatcttgaatctgataccttgaga
aatcaccttacagtgcttgctgaatcattgaataaagcaaggtccatgatatatcctccc
cttaatagagcatcaaaaattggagattctttacctggtttagctgaggttgtggagaag
gaacataagaagcttcttgctcgtaaaacaatcattgagcagcgcaaagaggaacaagaa
cgccagcttttggagaaggagcgtgaggaagagttaaagagactacagcagcagaaaaat
aatgaggaagctgaacagaaaaggcttgctattgaattggagaagaggaaaattcagcgc
atccaaaaggaaattgaagaacgtgagaaagaagaaacaaaagctctgattcaggaaaaa
ttctccaaaaataagaagaaaccacttattgaaggggataatttgacaaaacaacaattg
atggagttggctctcaatgagcagctgaaggagaaacaagaaatggagaaaaaattgcag
aagttgagcaagcagatggattattttgagagagctaagagggaggaggcagctccacta
attgaatctgcatatcaacaacgcttggttgaggaacagcttcttcatgagcgtgagcaa
cagcttgaggttgagctcagcaggcagcgtcatgatggtgaccttcaggagaagaataga
cttgctcgtgtaatggaaaacaagaaaattttccaagaaagagtggtgagtcaccgccag
tctgaattcgaaagattgagacaagaacgggaggagcatttccatcaaattcgcgaggca
cgtaaacaggaaagggtagctcagcggaagatgcttttctatttgagatcagaagaggaa
aaattgaacaggctgcgcgaagaggaggatgcacggaagcgtgaagaggctgagagaaga
agaaaggaagatgctgagcaccaagctaagctggatgaaattgcagagaagcaacggcaa
cgagagcgggaacttgaagaaaaggagaggttgagaagacagaagattcttgctggtgag
gctgctcggtcttctgaggcttctcctcttgccaggcctcaggcagaggctgtacctgct
tcagcagcagcatcttctgctgctccagctgctgccgctgctgctccagcacctacaaga
tatgttcctagacacttgcgggagaacgctgctgtgccagccccagctccaactgctgat
aggtggcgaagtactgatcgccgtggttcaggtgggggcagttcaaggcccacttggtga

DBGET integrated database retrieval system