KEGG   Chenopodium quinoa (quinoa): 110736294Help
Entry
110736294         CDS       T05764                                 

Definition
(RefSeq) non-specific phospholipase C2-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00562  Inositol phosphate metabolism
cqi00564  Glycerophospholipid metabolism
cqi00565  Ether lipid metabolism
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110736294
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110736294
   00565 Ether lipid metabolism
    110736294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cqi02042]
    110736294
Enzymes [BR:cqi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     110736294
Bacterial toxins [BR:cqi02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   110736294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 110736294
NCBI-ProteinID: XP_021772171
Position
Unknown
AA seq 535 aa AA seqDB search
MKFNNKNRSIPYFIHSFLFILIIILQNNHILLIHGSPSPIKTVVILVMENRSFDHMLGWM
KKLNPKIDGVNGSESNRVSLSEPDSPVIYYNDTAHYVVDPDPGHSFQAMREQIFGSDQTG
SDPAPMNGFAQQAYSINKSMEMARHVMNGYRPEMVPVYQALVQEFAVFDRWFASAPTSTQ
PNRLFIHSATSAGATSNIPALLAKGYPQRTIFENLDSEGISFGIYYQNIPATLFYRNLRK
LKYVTKFLPYGTFFKRHAKEGKLPSYVVVEQRYTDTKANPANDDHPSHDVYHGQLFVKEV
YETLRASPQWNETLFLITYDEHGGFYDHVPSPVSGVPSPDGIVGPEPFLFKFDRLGVRVP
TIAISPWIEKGTVVHKAKGPYPTSEYEHSSIAATVKKLFNLSSPFLTKRDAWAGTFEGIV
QTRTEPRTDCLVQLPMPVKMRQGEADENRQLSEFQQELMHLAAVMKGDDILSSYPESIAK
GMTVKQGKEYMEDAVKRFFEAARLAKKLGVHEEQIVKMRPSLTSRPLKSDTQQHP
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaacaacaaaaataggagtatcccttatttcattcattcatttctatttatc
ctaattattatcctccaaaataaccacattcttttaatccacggttcacctagccccatc
aaaaccgttgttattttagtaatggaaaaccggtccttcgaccacatgttgggttggatg
aaaaaactcaacccgaaaatcgacggcgtaaacgggtccgagtcaaaccgggtttctctc
tctgaaccggactctccggttatttattacaatgacacggctcattatgtggttgacccg
gacccgggtcactcatttcaagcaatgagagaacagatttttgggtcggaccaaaccggg
tctgatccggcccctatgaatgggttcgcacagcaagcgtattcgattaataagagtatg
gaaatggctagacatgttatgaatggttatagacccgaaatggttccggtatatcaagct
ttggttcaagaatttgccgtgttcgaccggtggtttgcttccgctccgacctcgactcaa
ccgaaccggctttttattcactcggctacttcagctggggctactagtaatatcccggcc
ttactcgctaaagggtaccctcaaaggacaatattcgagaacttggatagtgaaggaata
tcctttggaatttactaccaaaatattcctgccacattgttctaccgcaatctaagaaag
ctcaagtatgtcacaaaatttttaccctacggtacgtttttcaaaagacatgctaaagaa
gggaagctcccgagctacgtagtcgtggaacaacgttacacggacactaaggctaaccca
gccaacgacgatcacccatcacacgacgtgtaccatggtcaattgtttgtaaaggaggtg
tatgaaaccctaagggctagtccacaatggaatgaaaccctctttttgatcacatatgac
gagcatggtgggttttacgatcatgtccctagcccggttagtggggtccctagccccgat
ggtattgtggggccagagcctttcttatttaagtttgataggttgggagttcgggttcct
actatagcaatttcaccttggatcgagaagggtactgttgttcataaggctaaaggacca
tatccaacatcagagtacgagcactcgtcgattgcagctactgtcaagaaactcttcaac
ctgtctagccctttcctaactaaaagagatgcttgggctggcacctttgagggcattgta
caaacccgaactgaacctagaacagactgtcttgtgcaactgccaatgccggtgaagatg
aggcagggggaggcagatgaaaacaggcagctgagcgagtttcagcaagagctgatgcat
cttgcagcagtgatgaaaggtgacgacatactgtcaagttatcctgagagtatagctaaa
ggaatgacagtgaagcaagggaaggagtacatggaagatgcagtaaagcgattcttcgag
gcagcaagacttgccaagaagttgggagttcatgaagaacagattgtcaaaatgaggcct
tctctcacttcaagacctttaaaatctgacactcaacaacacccttaa

DBGET integrated database retrieval system