KEGG   Chenopodium quinoa (quinoa): 110738121Help
Entry
110738121         CDS       T05764                                 

Definition
(RefSeq) arogenate dehydratase/prephenate dehydratase 6, chloroplastic-like
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
cqi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    110738121
Enzymes [BR:cqi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     110738121
    4.2.1.91  arogenate dehydratase
     110738121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 110738121
NCBI-ProteinID: XP_021774179
Position
Unknown
AA seq 440 aa AA seqDB search
MQALSPSPTTTGTPNPLRTRQPTTTTTRLSFHPSQLTIRCSAFGRNGAVSGTRADWQSSC
AILASKVLSSQQTPAAGDGGAGEKPDEITTVNGHKTLNLLPIVSTAAATAAATTTNNLPK
PLSLSTDFSPAPMHGSTLRVAYQGVPGAYSEAAAGKAYPGCEAIPCDQFEVAFQAVELWI
ADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHP
QALAQCEHTLTKLGLNVTREAVDDTAGAAEYVATQSLRDTAAIASARAADLYGLQILADG
IQDDSGNVTRFVMLAREPIIPRTDRPFKTSIVFATHDNGEGKGTSSLFKVLSAFAFRNIS
LTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYVDFEASMAEPRAQNALAEVQEFTSFLR
VLGSYPMDMSPWSPSRSDDQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgctatctccgtcaccaaccaccaccggtacaccaaacccactccgaactcgt
caacccaccaccacaacaacccgactcagtttccacccgagtcaactcactatccgatgc
tccgccttcggtcgaaacggcgccgtttccggcacacgtgccgactggcaaagctcatgt
gcaatactcgcttctaaagtcctctcctcccaacaaactccggccgccggagacggcggc
gccggcgaaaaacccgacgaaatcaccaccgtgaacggccacaaaaccctaaatctcctc
ccaattgtctcaaccgccgccgcaacagccgccgcaacaaccaccaacaacctcccgaaa
ccactttctctctccaccgacttctcccctgctccaatgcacggctccactcttcgcgtc
gcttaccaaggcgttcccggcgcgtactccgaagccgccgccggaaaagcctaccctggt
tgcgaggccatcccttgcgatcaattcgaggtcgcgtttcaagcggtcgagctttggatc
gccgatcgtgctgttcttccggtggagaactctctcggtggttcgattcatcggaattac
gatcttttgctccggcatcggttgcatattgttggcgaggttcagcttccagtgcaccat
tgcttgttggcgttgcctggggttcggaaggagtatctcacgcgcgttatttcgcaccct
caagcgcttgctcagtgtgaacatacgttgaccaagttagggttgaatgttactagagaa
gctgttgatgatactgctggtgctgctgagtatgttgctacccagagtttgagggatact
gccgctatcgcctccgcacgcgctgccgatctttacggcttgcagatattggctgatggt
atacaagatgactctggaaatgtgacccggtttgttatgttagcccgggagccgattatt
ccccgaaccgaccggccttttaaaacaagtattgtgtttgcaacccatgacaacggggag
ggtaagggaacctcatccttattcaaggttctttcggcgtttgcctttaggaacattagc
ctaacaaagattgagagccggccccaccgccaccggcctattaggctcgtggacgatgcc
aatgtggggacggctaagcattttgagtacatgttctacgttgacttcgaggcgtctatg
gccgagccaagagctcaaaatgccctagctgaggttcaggaattcacttcattcttaagg
gttttggggagttatcctatggatatgtcaccgtggtcgccgtcgcgttcggatgatcaa
taa

DBGET integrated database retrieval system