KEGG   Chenopodium quinoa (quinoa): 110738625Help
Entry
110738625         CDS       T05764                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 50-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cqi03041]
    110738625
   03009 Ribosome biogenesis [BR:cqi03009]
    110738625
Enzymes [BR:cqi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110738625
Spliceosome [BR:cqi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    110738625
Ribosome biogenesis [BR:cqi03009]
 Eukaryotic type
  90S particles
   Helicases
    110738625
  Pre-60S particles
    110738625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C SNF2_N ResIII Helicase_C_2
Motif
Other DBs
NCBI-GeneID: 110738625
NCBI-ProteinID: XP_021774709
Position
Unknown
AA seq 683 aa AA seqDB search
MAVSSSSMNTAFASPQSEFMSLLKQRFSSFHPWRPHLAANPKLPAIFTPKSRSMTVRVNA
GYKKRPMDAPGAYELIDEESGQKVILWGGVDDVEPSIPSKKVLSWTPSKDKKKSSNAREI
VEGSEPSSAVQKNVMSSPTTLRLSKGIGRLKAVKIKSIVRRTSREKEKTNDYRYEEPDLD
ELDNDDDPIVSSDPQGVWIRKKNISAKSGIEQLMENKLSRKPVERKDNLTDAGSYVSATH
SRGWNDREPRRAYRGESRDLTPTRKYNAGSDFFSRKSFRESGCGDEMIEALRVQDFVRPS
NIQAMAYSPVVEGKSCIIADQSGSGKTLAYLAPVIQRLRQEEIEGISKSAAKSPRAVILV
PTAELASQVLLNCRSISKHGVPFRSMVATGGFRQRTQLQTLEQDLDVLIATPGRFMYLIK
EGFLHLTNLRCAVLDEVDILYSDEDFEQALHSLINTAPVTTQYLFVTATLPVEIYNKLVE
TFPDSEVIMGPGMHRTSSGLEEVLVDCSGNEGSEKTPETAFANKKSALLKLAEEIRVSRT
IIFCNKIETCRKVENALRRLDRNENQIRVLPFHAALEQETRLTNMKEFLNSNTENRSLFL
ICTDRASRGIDFPSVDHVVLFDFPRDPSEYVRRVGRTARGAGGIGKAFVFVVGKQVSLAR
RIIERNLKGHPLHEVPSAYELVR
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttcttcatcttccatgaacaccgcctttgcttctcctcaatccgaattcatg
tctctactcaaacaacgcttcagttcatttcatccatggcgtcctcacctcgcagctaac
cccaaacttcccgccatttttacgcctaaatcgagaagtatgacggttagggttaatgct
ggttacaagaagaggccgatggatgcaccgggggcgtacgagttgattgatgaggagagt
ggtcagaaagtgattctttggggtggagttgatgatgttgaaccttcaattcctagtaag
aaagtactttcctggactcctagtaaggataagaagaaatcttcgaatgctcgggaaatt
gttgaaggcagtgaaccttcgtctgctgttcagaaaaatgttatgtcatctccaactact
ctaagattgtctaagggtattggaaggttgaaagctgtcaaaatcaaaagcattgtaaga
aggacttcaagagaaaaggagaaaactaacgattatagatatgaagagccagatttggat
gaactagataatgatgatgatccaattgtatcgtcggatcctcaaggtgtctggatcaga
aagaaaaatatttctgctaagagtggcattgagcagctcatggaaaataaattgtcaagg
aaacctgttgagcgaaaggataacttgactgatgctggctcatatgtttctgctactcat
tcaagaggatggaatgatagagaaccaagacgtgcttataggggtgaatcaagagacttg
acacctacacgtaaatataatgctgggagtgactttttcagtcgaaaatcatttagagaa
tcgggttgtggtgatgaaatgattgaggctctgagggtacaggattttgttcgcccttca
aacattcaggcaatggcatattctcctgtggtagaggggaagagctgcattatagctgat
caaagtggatcagggaaaacattggcatacctggctccagttattcagcgtcttagacaa
gaagagattgaaggaattagtaaatcggcagcaaaaagtcctcgagctgtaatattagtc
ccaactgccgagctagcttcccaggttctgctgaattgtcgatccatctcaaaacatggt
gttcccttccggtctatggttgcaacaggaggctttcgacagcgaactcagttgcagact
cttgaacaggatttggacgtgcttattgccacaccgggacgtttcatgtacttaatcaaa
gaagggtttttacatttgacaaaccttagatgtgctgtgttggatgaagtggatatactc
tatagtgatgaagattttgaacaagctttgcatagtctaataaacacagcaccagttact
acgcagtacctcttcgtgactgccacattacctgtggaaatttacaacaaattagttgag
accttcccagatagtgaggtgatcatgggtcctggaatgcatcggacgagctccggtctt
gaagaggttcttgtagattgtagtgggaatgaagggtcagaaaagaccccagaaacagcg
tttgccaataagaagtctgccctcttgaagcttgcagaggagattcgagtttctaggact
attatattctgtaataagattgagacatgtcgaaaggttgagaatgccctgagacgtctt
gatagaaacgaaaatcagatacgagttttaccatttcatgctgctttggaacaagaaaca
aggctcacgaatatgaaggagttccttaattcgaatacagaaaaccgctctctgtttcta
atttgcactgacagggcttcacggggaattgattttcctagcgtggatcacgttgtactg
tttgacttccctcgcgatcctagtgaatatgtacgtcgtgttggcagaacagcaagaggt
gcaggaggtataggcaaggcgtttgtgtttgttgttggtaagcaagtttctctggcgagg
aggatcatcgaaagaaatttaaagggtcatcctttacatgaagtgccttctgcttatgaa
ttagtacggtga

DBGET integrated database retrieval system