KEGG   Chenopodium quinoa (quinoa): 32958982Help
Entry
32958982          CDS       T05764                                 

Gene name
rpl22, CDC77_pgp023
Definition
(RefSeq) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    32958982 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cqi03011]
    32958982 (rpl22)
Ribosome [BR:cqi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    32958982 (rpl22)
  Bacteria
    32958982 (rpl22)
  Archaea
    32958982 (rpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 32958982
NCBI-ProteinID: YP_009380170
Position
CP
AA seq 193 aa AA seqDB search
MGFFKKKEKKSEFDVFRLYGSRHPEPGQCDEITTRGHSLSMSVDKARRVIDQIRGRSYAE
TLMILELMPYRACYPIFKLIYSAAANASHNKQFNKANLIISKADVNKGITLKKLKPRARG
RSYLIKKPTCHITIVLRDITHFDSYEKFLESLPPKKLITSLGLMSTGRRREFLCGRFREK
HKIKSFLYNIAFV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggtttttttaaaaaaaaagaaaagaaatcagaatttgatgtctttcgtctatacgga
tcgcgtcacccagagccgggacaatgtgatgagataactacaagaggtcattctctatcc
atgtctgttgacaaagcacgaagagtaattgatcagatacgcggtcgttcctacgccgaa
acacttatgatattagaactcatgccctatcgagcatgttatcctatttttaaattgatt
tattctgcagcagcaaatgctagccacaataaacaattcaacaaagcaaatttaattatt
agcaaagctgacgttaataaaggtattaccttaaaaaaattaaaaccgcgagctcgaggg
cgtagttatctgattaaaaaacctacttgtcacataactattgtattaagagatataacc
cactttgattcatatgagaaatttttagagagtttacctccaaaaaagctaataacttcc
ttaggtcttatgtctacaggtcgacgacgcgaattcttgtgtggtcgttttagagaaaag
cataaaataaagagtttcttatacaatatagcctttgtatga

DBGET integrated database retrieval system