KEGG   Chenopodium quinoa (quinoa): 32959020Help
Entry
32959020          CDS       T05764                                 

Gene name
psbD, CDC77_pgp069
Definition
(RefSeq) PsbD
  KO
K02706  photosystem II P680 reaction center D2 protein [EC:1.10.3.9]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00195  Photosynthesis
cqi01100  Metabolic pathways
Module
cqi_M00161  Photosystem II
cqi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    32959020 (psbD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:cqi00194]
    32959020 (psbD)
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     32959020 (psbD)
Photosynthesis proteins [BR:cqi00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    32959020 (psbD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Photo_RC PEMT
Motif
Other DBs
NCBI-GeneID: 32959020
NCBI-ProteinID: YP_009380125
Position
CP
AA seq 353 aa AA seqDB search
MTIAVGKFTKDEKDLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY
THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA
FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF
RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ
AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV
SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactatagccgttggtaaatttactaaagacgaaaaagatttatttgatagtatggat
gactggttacggagggaccgtttcgtttttgtaggttggtctgggctattgctctttcct
tgtgcttatttcgccttaggaggttggtttacaggtacaacctttgtaacttcatggtat
acccatggattggccagttcttatttggaaggttgcaatttcttaaccgcggcagtttct
actcctgctaatagtttagcccactctttattgttactgtggggtcctgaagcacaagga
gactttactcgttggtgtcaattaggcggcctgtggacttttgttgctcttcatggtgct
ttcgcactaataggttttatgttacgtcaattcgagcttgctcgatccgttcaattgcgc
ccttataatgcaatcgcattctctggtccaattgctgtttttgtttctgtattcctaatt
tatccactaggtcagtctggttggttctttgcacctagttttggtgtagcagctatattt
cgattcattctcttttttcaagggtttcataattggacactgaatccatttcatatgatg
ggagttgccggtgtattgggcgccgctctactatgcgctattcatggcgctaccgtagaa
aatactttatttgaagacggtgatggggcaaatacattccgggcttttaacccaacccaa
gccgaagaaacttattcaatggtcaccgctaaccgcttttggtcccaaatttttggggtt
gctttttccaataaacgttggttacatttctttatgttatttgtaccagtaaccggttta
tggatgagtgctcttggagtagtcggtctggctttgaacctacgtgcctatgacttcgtt
tcccaggaaatccgtgcagcggaagatcctgaatttgaaactttctacaccaaaaatatt
ctcttaaacgaaggtattcgtgcttggatggcggctcaagatcagcctcatgaaaacctt
atattccctgaggaggttctaccccgtggaaacgctctttaa

DBGET integrated database retrieval system