KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000005
Entry
CpipJ_CPIJ000005  CDS       T01079                                 
Name
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00620  Pyruvate metabolism
cqu00630  Glyoxylate and dicarboxylate metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CpipJ_CPIJ000005
   00630 Glyoxylate and dicarboxylate metabolism
    CpipJ_CPIJ000005
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CpipJ_CPIJ000005
SSDB
Motif
Pfam: Malate_synthase
Other DBs
NCBI-ProteinID: EDS25628
VectorBase: CPIJ000005
UniProt: B0VZ37
AA seq 562 aa
MDSLKRVCVERAPHRLEEAHGELFTQGALGFLAELLAEFDDDVEKLLRRRLERRLHIKQG
RWKPEFRNSSEDQDWKIEELPARLRNRKLDLGDVSPANTTNFVDCLYAKVQGIQVDFDDG
HCPTWRNTVQGLYNVTRAVHARLPGAPADIQQCPVLMLRPRAFNMIEHHCMVNGKEVVGP
LFDFAILMYHNAKLMASLDVGPYFYLSKVICALVQSNMILYKVLQIEGPNETQLWNKIFT
WTEHRLGLRRGTIKACVLIENILAAYRMEDILYSLREHAIGLNCGIWDYSASIIAKFGDS
PDFLIPDRNKYVNMGQPFLANYMRLLINVCHRRGALATGGMAAKLLPCGKGSNSLADEIT
ESVKQAKSVEIDAGVDGFMVYDLRIVDAVNEMWQRKCPGDNQLSILPDVDRITAASLVKI
PEGGVTIEGLNHNISVALLFIYHWFTGSGVFYLNGAVEDSATAEISRSQIWQWIRHRAAI
EGKPDVLVTRSLVYTMLDGIISRAYKSWCTSIPDRKRLLSSKYVLLEIISAREYIEYITT
YLNDSHKFRTLHNKNDGLESKL
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggatagtctaaagcgggtttgtgtcgagcgggctccccatcggctggaggaagctcac
ggtgaacttttcacccaaggtgccctcggattcttggccgaactgctcgccgaatttgat
gacgacgttgaaaagctcttgagacgcagattggagcgtcggctgcacatcaaacagggt
cgatggaagccggaattccggaacagcagtgaagaccaggattggaagatcgaggagctt
ccggcgaggctgcgcaatcgaaagcttgatttgggtgatgtaagcccggcgaacacgacc
aactttgtggactgtctgtacgccaaggttcaaggcattcaggtggactttgacgatgga
cactgtccgacgtggcggaacacggtgcaagggttgtacaatgttacgagagcggttcac
gcgaggctacctggggcgccggcagatattcagcagtgtccggtgttgatgctaagaccg
agggcgttcaacatgatcgagcatcactgcatggtcaatgggaaggaagtggttgggccg
ttgtttgattttgccatattgatgtaccataatgcgaagttgatggccagtttggacgtt
ggaccttacttttatttgtcgaaggtaatttgtgcgttggtacaatcaaacatgatccta
tacaaagtattacagatcgaaggccccaacgaaactcaactgtggaacaaaatcttcact
tggaccgagcatcgccttggtctccgccggggaaccattaaagcttgcgtcctgatcgag
aacattttggctgcgtaccgcatggaggacattctgtactcactccgggagcatgccata
gggctgaactgcggcatttgggactattcggcgagtatcatcgcaaagtttggcgacagt
ccggactttttgattccggaccggaacaagtacgtgaatatgggtcaaccgtttctggcg
aattacatgcgcctgttgatcaacgtttgccataggcgaggagcgctggccaccggtgga
atggccgccaagttactgccctgtgggaaggggtcgaacagtttagcggacgaaattaca
gagagcgtaaaacaagccaagtcagtggaaattgacgctggagttgatggtttcatggtt
tacgatcttcgtattgttgacgccgtcaacgaaatgtggcagagaaaatgtccaggcgac
aaccaactatcgatcctcccagatgtagatcggatcactgcagctagtctcgtaaagatt
ccggaaggtggagtcacaattgaagggctcaatcacaacatatcggtagccttactcttt
atctaccactggttcaccgggagtggtgtgttctatctgaacggcgccgtggaagattca
gcaacggcggagatttcccgatcacagatttggcaatggattcgccatcgggccgccatc
gagggcaaaccggacgtgcttgtgacgcgttcgctggtgtacaccatgctcgatgggatt
atttcccgggcgtacaagtcctggtgcacgtcgattccggacaggaagaggttactctcg
tccaagtacgtactgctggagattatctcggcgagggagtacattgagtacatcacgact
tatttgaacgatagccacaagtttagaacgctgcacaataagaacgatgggctggagtcg
aagttgtga

DBGET integrated database retrieval system